Optimized functional and structural design of dual-target LMRAP, a bifunctional fusion protein with a 25-amino-acid antitumor peptide and GnRH Fc fragment.

OA: gold CC-BY-NC-ND-4.0
AI-generated summary by qwen3.7-flash, 2026-08-28

The researchers developed LMRAP, a bifunctional fusion protein combining an antitumor peptide with a GnRH Fc fragment, which demonstrated prolonged half-life and significant inhibition of cancer cell proliferation and angiogenesis in vitro and in vivo.

One-sentence paraphrase of the abstract; not a substitute for reading it. No clinical advice. How this works

AI-generated deep summary by qwen3.7-flash, 2026-08-28 · read from full text

This study engineered a bifunctional fusion protein, LMRAP, by linking a 25-amino-acid antitumor peptide (AP25) targeting integrins to a GnRH Fc fragment to target cancers expressing GnRH receptors. The researchers optimized the structural design using flexible linkers and successfully produced the protein in Chinese hamster ovary cells, confirming its sequence and structural integrity through SDS-PAGE and LC-MS analysis. The paper highlights that while endometrial cells in endometriosis express GnRH receptors, the primary focus of this work is on developing a therapeutic agent for hormone-dependent malignancies such as prostate and breast cancer rather than treating benign gynecological conditions. Relevance to endometriosis: listed as one indication for GnRH antagonists, though the paper's main focus is uterine fibroids.

Read from the paper's body, not the abstract. Not a substitute for reading the paper. No clinical advice. How this works

Abstract

To develop fusion protein of a GnRH Fc fragment and the integrin targeting AP25 antitumor peptide for GnRH receptor-expressing cancer therapy. The LMRAP fusion protein was constructed. A transwell invasion assay was performed. The gene mRNA and protein levels of GnRHR-I, α5β1, and αvβ3 in different cancer cell lines were assessed. Cell proliferation was measured using a cell counting kit-8. An antagonist assay was performed on GnRH receptors. Anti-tumor activity was evaluated with a mouse xenograft tumor model. Immunohistochemistry (IHC) was applied to detect CD31 and CD34 expressions. Pharmacokinetic characteristics were determined with an indirect competition ELISA. The developed bifunctional fusion protein LMRAP not only inhibited HUVEC invasion, but also inhibited proliferation of GnRHR-I, α5β1, and αvβ3 high expression cancer cells. The IC50 for LMRAP in the GnRH receptor was 6.235 × 10-4 mol/L. LMRAP significantly inhibited human prostate cancer cell line 22RV1 proliferation in vivo and in vitro. LMRAP significantly inhibited CD31 and CD34 expressions. The elimination half-life of the fusion protein LMRAP was 33 h in rats. The fusion protein made of a GnRH Fc fragment and the integrin targeting AP25 peptide retained the bifunctional biological activity of GnRHR blocking, angiogenesis inhibition, prolonged half-life and good tolerance.
Full text 50,841 characters · extracted from pmc-nxml · 6 sections · click to expand

Results

According to the arrangement of AP25, GnRH, the Fc fragment and the flexible linker sequence, three fusion protein sequences were designed and named LMRAP, LMRAP-A and LMRAP-B. The domain arrangements are presented in Fig. 1 A. The target plasmid for each fusion protein was stably transfected into CHO-K1 cells. The clones with the highest expression levels of each fusion protein were selected for production and preparation of protein samples after stable transfection screening. The final products were identified with SDS-PAGE ( Fig. 1 B). Their primary sequences were confirmed with LC–MS/MS ( Fig. 1 C–E). The SDS-PAGE results indicated that the reduced molecular weights of three fusion proteins were each 34 kD. According to SDS-PAGE results, the non-reduced molecular weights of three fusion proteins were each 68 kD, indicating the presence of natural dimmers. We also confirmed the deglycosylated molecular weight with time-of-flight mass spectrometry (TOF-MS): the reduced molecular weight was 31,007 Da. This result matched the theoretical molecular weight (31,006 Da of monomer) very well. LC–MS/MS peptide mapping analysis indicated that their primary sequences were identical to the theoretical sequences. To screen the anti-tumor activities of fusion proteins LMRAP, LMRAP-A and LMRAP-B, their anti-tumor activities were evaluated by measuring the effect of in vitro experiments on the invasion of HUVECs. The results showed that AP25 had significant migration inhibition on HUVECs at 0.8 μmol/L. LMRAP inhibited HUVECs in a dose-dependent manner ( Fig. 2 A and B). Figure 2 LMRAP, LMRAP-A, but not LMRAP-B, inhibited the invasion activity of HUVECs. Cell invasive ability was determined with a transwell invasion assay employing Boyden chambers coated with Matrigel. HUVECs in serum-free media were put into the upper chamber of an insert. The cells were then treated with AP25, avastin, LMRAP-A, LMRAP, or LMRAP-B. The cells that had invaded through the membrane were stained with 0.1% crystal violet and methanol. The cells were then imaged and counted in random fields in each well under a microscope at 100× magnification. Data are representative of three independent experiments ( n  = 3) (A). The migration cell numbers (B) and the migration inhibition rate (C) are shown based on the number of invasion cells in the experiment in different groups. Data are mean±SD; * P  < 0.05, ** P  < 0.01 compared with the control group. Figure 2 LMRAP, LMRAP-A, but not LMRAP-B, inhibited the invasion activity of HUVECs. Cell invasive ability was determined with a transwell invasion assay employing Boyden chambers coated with Matrigel. HUVECs in serum-free media were put into the upper chamber of an insert. The cells were then treated with AP25, avastin, LMRAP-A, LMRAP, or LMRAP-B. The cells that had invaded through the membrane were stained with 0.1% crystal violet and methanol. The cells were then imaged and counted in random fields in each well under a microscope at 100× magnification. Data are representative of three independent experiments ( n  = 3) (A). The migration cell numbers (B) and the migration inhibition rate (C) are shown based on the number of invasion cells in the experiment in different groups. Data are mean±SD; * P  < 0.05, ** P  < 0.01 compared with the control group. The inhibition rates of each dose of AP25 in groups of 0.2, 0.4 and 0.8 μmol/L were 18.9 ± 8.9%, 28.4 ± 5.2% and 79.1 ± 5.3%, respectively. The inhibition rate of Avastin (0.17 μmol/L) was 73.9 ± 3.6%. The inhibition rates of each dose of LMRAP at 0.1, 0.2, 0.4, 0.8 and 1.6 μmol/L were 45.8 ± 5.9%, 43.8 ± 18.4%, 57.2 ± 10.2%, 76.6 ± 3.2% and 84.9 ± 2.8%, respectively. The inhibition rates of LMRAP-A at each dose of 0.1, 0.2, 0.4, 0.8, and 1.6 μmol/L were 17.8 ± 12.8%, 3.2 ± 18.8%, – 13.6 ± 28.7%, 44.6 ± 21.5%, and 70.7 ± 9.5%, respectively. The inhibition rates of LMRAP-B in the 0.1, 0.2, 0.4, 0.8, and 1.6 μmol/L groups were – 27.0 ± 16.1%, – 1.4 ± 18.6%, – 6.6 ± 7.7%, 13.0 ± 9.3%, and 28.2 ± 12.7%, respectively ( Fig. 2 C). In this invasion inhibition experiment of AP25 fusion protein samples LMRAP, LMRAP-A, and LMRAP-B, the invasion inhibition activity of samples LMRAP and LMRAP-A at high concentrations was similar to that of AP25. Compared with the blank control group, LMRAP-B did not inhibit the invasion activity of HUVECs at all concentrations. The mRNA and protein expression levels of GnRHR-I, α 5 β 1, α v β 3 were analyzed in human prostate cancer cells (22RV1, DU145, PC-3, and LNCaP), human ovarian cancer (SKOV3, OVCAR-3, SW626, and A2780) and human cervical-cancer cell lines (SiHa and HeLa). The results shown in Fig. 3 indicate that human prostate cancer 22RV1, human ovarian cancer SKOV3 and human cervical cancer SiHa had high GnRHR-I expression, while human prostate cancer PC-3 and human ovarian cancer A2780 had medium GnRHR-I expression ( Fig. 3 A and F). Human cervical cancer SiHa, human ovarian cancer SKOV3 and human prostate cancer PC-3 had high α 5 β 1 expression, while human ovarian cancer A2780, human prostate cancer 22RV1 and DU145 had medium α 5 β 1 expression ( Fig. 3 B, C and F). Human ovarian cancer SKOV3 and human cervical-cancer cell lines SiHa and HeLa had high α v β 3 expression, while human prostate cancer 22RV1 had medium α v β 3 expression ( Fig. 3 D–F). Figure 3 The mRNA and protein levels of GnRHR-I, α 5 β 1, and α v β 3 were measured with real-time PCR and Western blot in different cancer cell lines. The SKOV3 human ovarian cancer and 22RV1 human prostate cancer cells had high GnRHR-I expression (A). Human cervical cancer SiHa, human prostate cancer PC-3 and human ovarian cancer A2780 had medium GnRHR-І expression (A). Human cervical cancer SiHa and human ovarian cancer SKOV3 had high α5β1 expression. Human ovarian cancer A2780, human prostate cancer 22RV1 and PC-3 had medium α5β1 expression (B and C). Human ovarian cancer SKOV3 had high α v β 3 expression. Human prostate cancer 22RV1 had medium α v β 3 expression (D and E). Data are mean±SD, n=3. The protein expression levels of GnRHR-I, α 5 β 1, and α v β 3 were measured by Western blot in different cancer cell lines (F). Figure 3 The mRNA and protein levels of GnRHR-I, α 5 β 1, and α v β 3 were measured with real-time PCR and Western blot in different cancer cell lines. The SKOV3 human ovarian cancer and 22RV1 human prostate cancer cells had high GnRHR-I expression (A). Human cervical cancer SiHa, human prostate cancer PC-3 and human ovarian cancer A2780 had medium GnRHR-І expression (A). Human cervical cancer SiHa and human ovarian cancer SKOV3 had high α5β1 expression. Human ovarian cancer A2780, human prostate cancer 22RV1 and PC-3 had medium α5β1 expression (B and C). Human ovarian cancer SKOV3 had high α v β 3 expression. Human prostate cancer 22RV1 had medium α v β 3 expression (D and E). Data are mean±SD, n=3. The protein expression levels of GnRHR-I, α 5 β 1, and α v β 3 were measured by Western blot in different cancer cell lines (F). Since LMRAP-B showed no obvious inhibitory effect on HUVEC invasion, LMRAP-B was not a good structure for further research. To assess the in vitro antiproliferative effect of LMRAP and LMRAP-A, cancer cells with different GnRHR-I, α 5 β 1, and α v β 3 integrin expression levels were incubated with a series of increasing doses of LMRAP or LMRAP-A. Cell viability was determined with CCK-8. The results shown in Fig. 4 indicate that LMRAP significantly inhibited GnRHR-I, α 5 β 1, and α v β 3 integrin high-expression cell viability in human prostate cancers 22RV1 and PC-3 ( Fig. 4 A and D) and human ovarian cancer SKOV3 as well as A2780 cells ( Fig. 4 B and C) in vitro from 6.25 to 12.5 μmol/L ( P  < 0.05), while LMRAP-A inhibited in vitro cell viability in 22RV1, PC-3 cells over 50 μmol/L. From 20 to 50 μmol/L, AP25 inhibited cell viability in PC-3 and SiHa cells in vitro ( Fig. 4 D and E). Gonadorelin showed no significant effect on cell proliferation for all tested cells in vitro . LMRAP had an improved cell proliferation inhibitory effect compared with AP25, which indicated that the GnRHR-I-specific binding of LMRAP might promote cytotoxicity of AP25. On the contrary, LMRAP did not show an obvious proliferation inhibition effect on cancer cells with low expression of GnRHR-I, α 5 β 1, or α v β 3 integrin ( Table 1 ). LMRAP showed the best antiproliferation activity compared with LMRAP-A and AP25. Figure 4 The in vitro antiproliferative effect of LMRAP and LMRAP-A on GnRHR-I expression cells was determined by CCK-8. LMRAP significantly inhibited GnRHR-I positive cell viability in human prostate cancer 22RV1 (A) and PC-3 (D), human ovarian cancer SKOV3 (B), and A2780 (C) cells in vitro from 6.25 to 12.5 μmol/L. AP25 itself inhibited cell viability in 22RV1 (A), SKOV3 (B), A2780 (C), PC-3 (D) and SiHa (E) cells in vitro from 25 to 50 μmol/L. Data are mean±SD, n =6; * P <0.05, ** P <0.01 vs . Control. Figure 4 Table 1 The IC 50 of LMRAP and LMRAP-A on cells with different expression levels of GnRHR-I and integrin. Table 1 Cell line GnRHR-I α 5 β 1 α v β 3 IC 50 (μmol/L) LMRAP LMRAP-A AP25 HeLa ± ± +++ – – – SW626 ± ± + 255.2 290.8 220.9 OVCAR-3 ± ± + 276.2 376.2 352.1 DU145 ± ++ ++ 212.3 – 1354 LNCap ± + ± 144.8 186.1 229.3 22RV1 +++ ++ ++ 14.42 51.58 818.0 SKOV3 +++ +++ +++ 85.38 86.97 990.9 A2780 ++ ++ ++ 37.94 122.9 271.2 PC-3 ++ +++ ++ 19.37 60.72 176.6 SiHa +++ +++ +++ 63.74 234.3 137.0 ±Very weak expression; +low expression; ++medium expression; +++high expression; –no activity. The in vitro antiproliferative effect of LMRAP and LMRAP-A on GnRHR-I expression cells was determined by CCK-8. LMRAP significantly inhibited GnRHR-I positive cell viability in human prostate cancer 22RV1 (A) and PC-3 (D), human ovarian cancer SKOV3 (B), and A2780 (C) cells in vitro from 6.25 to 12.5 μmol/L. AP25 itself inhibited cell viability in 22RV1 (A), SKOV3 (B), A2780 (C), PC-3 (D) and SiHa (E) cells in vitro from 25 to 50 μmol/L. Data are mean±SD, n =6; * P <0.05, ** P <0.01 vs . Control. The IC 50 of LMRAP and LMRAP-A on cells with different expression levels of GnRHR-I and integrin. ±Very weak expression; +low expression; ++medium expression; +++high expression; –no activity. Based on computer construction technology, the three parts of AP25, GnRH, and Fc were relatively independent when changing flexible linkers and the combination of spatial structure and epitope did not affect each other. Antagonist assay results on the GnRH receptors of gonadorelin and LMRAP in a CHO-K1/GnRHR/G α 15 stable cell line is shown in Fig. 5 . The IC 50 s for gonadorelin ( Fig. 5 A) and LMRAP ( Fig. 5 B) were 1.641 × 10 −9 and 6.235 × 10 −4  mol/L, respectively. Figure 5 Functional characterization of LMRAP. The antagonist assay on GnRH receptors of gonadorelin and LMRAP in the CHO-K1/GnRHR/G α 15 stable cell line showed the IC 50 for gonadorelin was 1.641 × 10 −9  mol/L (A) and LMRAP was 6.235 × 10 −4  mol/L (B). Data are mean±SD, n=3. Figure 5 Functional characterization of LMRAP. The antagonist assay on GnRH receptors of gonadorelin and LMRAP in the CHO-K1/GnRHR/G α 15 stable cell line showed the IC 50 for gonadorelin was 1.641 × 10 −9  mol/L (A) and LMRAP was 6.235 × 10 −4  mol/L (B). Data are mean±SD, n=3. The xenograft tumor model of nude mice was established by s.c. flank injection of human prostate cancer cell line 22RV1. This model was further used to evaluate the therapeutic efficacy of LMRAP in vivo . Different doses of LMRAP were injected into the tail vein for 14 consecutive days to evaluate the anti-tumor activity of LMRAP against human prostate cancer. The results showed ( Fig. 6 A and B) that the relative tumor volume (RTV) of treatment group/RTV of control group (T/C, %) of LMRAP 12.5, 25 and 50 mg/kg for transplanted tumors of 22RV1 nude mice were 56.34%, 47.44%, and 32.16%, respectively, and the inhibition rates were 29.56%, 48.00%, and 61.97%, respectively. The T/C (%) of the control drugs AP25, gonarellin, the AP25/gonarellin combination, and avastin, were 70.83%, 82.19%, 50.52% and 15.23%, respectively, and the inhibition rates were 37.59%, 18.80%, 52.70%, and 82.72%, respectively. There was no significant difference in body weight gain between the treatment group and the model group, which indicated that no general toxicity was caused by the treatments. Figure 6 In vivo anti-tumor study of LMRAP. Xenograft 22Rv1 tumors were induced by s.c. flank injection in nude mice. This model was used to assess the therapeutic efficacy of LMRAP in vivo . Tumor growth curve (A) and the tumor weight (B) of tumor bearing nude mice showed that the T/C (%) of LMRAP 12.5, 25, and 50 mg/kg for transplanted tumors of 22RV1 nude mice were 56.34%, 47.44%, and 32.16%, respectively, and the inhibition rates were 29.56%, 48.00%, and 61.97%, respectively. ** P  < 0.01 compared with the model group (Data are mean±SD, n  = 8 per group except n  = 16 in model group). Figure 6 In vivo anti-tumor study of LMRAP. Xenograft 22Rv1 tumors were induced by s.c. flank injection in nude mice. This model was used to assess the therapeutic efficacy of LMRAP in vivo . Tumor growth curve (A) and the tumor weight (B) of tumor bearing nude mice showed that the T/C (%) of LMRAP 12.5, 25, and 50 mg/kg for transplanted tumors of 22RV1 nude mice were 56.34%, 47.44%, and 32.16%, respectively, and the inhibition rates were 29.56%, 48.00%, and 61.97%, respectively. ** P  < 0.01 compared with the model group (Data are mean±SD, n  = 8 per group except n  = 16 in model group). Considering the importance of angiogenesis in prostate cancer progression, we further evaluated angiogenesis by IHC analysis of CD34 and CD31 expression in the xenografted 22Rv1 tumors. The results in Fig. 7 A and B show that LMRAP significantly inhibited both CD31 and CD34 expression in prostate cancer ( P  < 0.01). Figure 7 IHC detection of CD31 and CD34 expressions. Histological sections from FFPE xenograft tumors were used. (A) Positive signal of CD31 and CD34 in the model group, LMRAP (50 mg/kg) and Avastin (5 mg/kg). (B) CD31 and CD34 expression densities were independently assessed. LMRAP significantly inhibited both CD31 and CD34 expressions in prostate cancer. Data are mean±SD of eight independent experiments ( n  = 8). ** P  < 0.01 compared with the model group. The bar = 50 μm. Figure 7 IHC detection of CD31 and CD34 expressions. Histological sections from FFPE xenograft tumors were used. (A) Positive signal of CD31 and CD34 in the model group, LMRAP (50 mg/kg) and Avastin (5 mg/kg). (B) CD31 and CD34 expression densities were independently assessed. LMRAP significantly inhibited both CD31 and CD34 expressions in prostate cancer. Data are mean±SD of eight independent experiments ( n  = 8). ** P  < 0.01 compared with the model group. The bar = 50 μm. First, the working concentration of coated antigen and monoclonal antibodies was established. The optimal working concentration of coated antibodies and antigens was determined with the square array method. The antigens were diluted to 1:200, 1:400, 1:800, 1:3200, 1:6400, and 1:12,800 times and negative pore, and were coated transversely into the enzyme plate. After washing, the antibodies were diluted at 1:2 K, 1:4 K, 1:8 K, and 1:16 K and added vertically for ELISA detection. Finally, the dilution factor of OD 450 nm equal to 1.0 was chosen as the ideal concentration. According to the test results, the optimal concentration of the antigen was 1:800 and the dilution ratio of the monoclonal antibody was 1:4 K. The dilution ratio of the secondary antibody was 1:2000, which was the optimum concentration. The three batch standard curves of the LMRAP concentration in SD rat plasma ranged from 12,800 to 100 ng/mL. The curve equations were y  = 6.2824 − 2.0017 x and y  = 6.1193 − 1.7859 x and y  = 8.1738 − 2.5234 x . The linear exponents R 2 were 0.9901, 0.9902, and 0.9974, respectively. The intra-batch precision of high (10,000 ng/mL), medium (1000 ng/mL), and low (200 ng/mL) concentration quality control samples was 9.39%, 5.87%, and 7.26%, the inter-batch precision was 10.55%, 7.42%, and 8.14%, and the recovery rates were 111.00%, 97.10%, and 100.64%, respectively. After tail vein injection of 12.5 mg/kg LMRAP in SD rats, the curve of the blood drug concentration–time is shown in Fig. 8 , and the pharmacokinetic parameters are shown in Table 2 . The results showed that the pharmacokinetic process of LMRAP in SD rats was a one-compartment model after intravenous administration of 12.5 mg/kg LMRAP. The maximum plasma concentration ( C max ) was 93.346 ± 15.722 μg/mL. The elimination half-life ( t 1/2 β ) was 33.332 ± 11.189 h, area under the concentration–time curve [AUC (0–216) ] was 539.94 ± 155.243 mg/L·h, clearance (CL) was 0.038 ± 0.036 L/h, and apparent volume of distribution ( V d ) was 1.787 ± 1.527 L/kg. This method was based on an indirect competitive ELISA for the LMRAP monoclonal antibody, with high specificity and accurate results. Figure 8 Plasma concentration–time curve of LMRAP following a single i.v. administration to a rat at a dose of 12.5 mg/kg. Data are mean±SD, n =6. Figure 8 Table 2 Pharmacokinetic parameters of LMRAP following a single i.v. administration to rat at a dose of 12.5 mg/kg. Table 2 Parameter Unit Animal Mean SD 1 2 3 4 5 6 α , K e h −1 0.240 0.000 0.384 0.000 0.000 1.131 0.293 0.402 t 1/2 β h 45.237 29.187 50.979 18.256 27.879 28.452 33.332 11.189 V d L/kg 1.832 0.419 2.622 0.731 0.426 4.693 1.787 1.527 T max h 0.000 1.000 0.167 0.083 0.500 0.000 0.292 0.359 AUC (0–216) mg/L·h 843.228 612.758 508.935 360.059 470.547 444.113 539.940 155.243 AUC (0–∞) mg/L·h 1931.013 1014.410 1417.535 388.813 521.421 1236.213 1084.901 525.430 CL L/h/kg 0.028 0.010 0.036 0.027 0.010 0.114 0.038 0.036 C max μg/mL 102.028 94.773 119.001 69.386 80.244 94.646 93.346 15.722 Plasma concentration–time curve of LMRAP following a single i.v. administration to a rat at a dose of 12.5 mg/kg. Data are mean±SD, n =6. Pharmacokinetic parameters of LMRAP following a single i.v. administration to rat at a dose of 12.5 mg/kg. Further determination of the MTD showed that the animals receiving LMRAP at 2560 mg/kg via i.v. injection for a single dose in one day did not show obvious toxicity. The animals received further LMRAP at 2560 mg/kg via i.v. injection three times a day. After 14 days' further observation, no animal mortality was observed, nor were there any obvious changes in animal body weight increase or animal behavior. The MTD of LMRAP was 7680 mg/kg via i.v. injection, which was 307.2 times of the pharmacodynamic dose (25 mg/kg).

Materials

Male BALB/c nude mice that were 6–8 weeks old, male and female BALB/c mice, and Sprague–Dawley (SD) rats were purchased from the Nanjing Model Animal Research Center (Nanjing, China). All animals were given water and sterilized food. The Animal Care and Use Committee of the Nanjing Han and Zaenker Cancer Institute approved the study and it was strictly performed according to the Guide for the Care and Use of Laboratory Animals. Peptide AP25 was synthesized by GL Biochem (purity > 95%). CD31 and CD34 antibodies were purchased from EnoGene (New York, NY, USA). Human prostate cancer 22RV1, DU145, PC-3, LNCap, human cervical cancer HeLa, SiHa, human ovarian cancer A2780, SW626, OVCAR-3, and SKOV3 cells were purchased from the American Type Culture Collection (ATCC, Manassas, VA, USA). All cells were routinely cultured in Roswell Park Memorial Institute-1640 medium (RPMI-1640, Gibco, Grand Island, NY, USA) with 10% fetal bovine serum (FBS, Gibco), 100 μg/mL streptomycin (Gibco), and 100 Units/mL penicillin (Gibco) and then maintained at 37 °C in a humidified incubator with 5% CO 2 . The sequence of AP25 was: ACDCRGDCFCGGGGIVRRADRAAVP. The sequence of LMRAP, GnRH-linker-hIgG4 Fc-linker-AP25 was: PHWSYGLRPGGGGGSGGGGSGGGGSESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSGGGGSGGGGSGGGGSIVRRADRAAVPGGGGACDCRGDCFC. The sequence of LMRAP-A, AP25-linker-hIgG4 Fc-linker-GnRH was: ACDCRGDCFCGGGGIVRRADRAAVPGGGGSGGGGSGGGGSESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSGGGGSGGGGSGGGGSPHWSYGLRPG. The sequence of LMRAP-B, AP25-linker-GnRH-linker-hIgG4 Fc was: ACDCRGDCFCGGGGIVRRADRAAVPGGGGSGGGGSGGGGSPHWSYGLRPGGGGGSGGGGSGGGGSESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLS. Fig. 1 A shows the domain arrangements of LMRAP, LMRAP-A, and LMRAP-B. Figure 1 Schematic of the domain arrangements and structural identifications of LMRAP, LMRAP-A, and LMRAP-B. (A) Schematic of LMRAP, LMRAP-A, and LMRAP-B domain arrangements. (B) SDS-PAGE analyses of the final products after being purified with affinity filler Prosep Ultra Plus. Marker: molecular weight marker; Lanes A–C: LMRAP-A (reduced), LMRAP-B (reduced), LMRAP (reduced), respectively; Lanes D–F: LMRAP-A (non-reduced), LMRAP-B (non-reduced), LMRAP (non-reduced), respectively. Confirmation of proteins sequences with LC–MS of LMRAP (C), LMRAP-A (D), LMRAP-B (E). Figure 1 Schematic of the domain arrangements and structural identifications of LMRAP, LMRAP-A, and LMRAP-B. (A) Schematic of LMRAP, LMRAP-A, and LMRAP-B domain arrangements. (B) SDS-PAGE analyses of the final products after being purified with affinity filler Prosep Ultra Plus. Marker: molecular weight marker; Lanes A–C: LMRAP-A (reduced), LMRAP-B (reduced), LMRAP (reduced), respectively; Lanes D–F: LMRAP-A (non-reduced), LMRAP-B (non-reduced), LMRAP (non-reduced), respectively. Confirmation of proteins sequences with LC–MS of LMRAP (C), LMRAP-A (D), LMRAP-B (E). The target genes of the three fusion proteins were cloned into EcoRI loci of the plasmid vector pEE12.4 by homologous recombination. The host bacteria were Trans1-T1 cells (Transgen Biotech, Beijing, China). TAA/TGA was set as the termination codon. After transformation, a transformed single colony was selected and inoculated into 2 mL Luria–Bertani (LB) medium containing ampicillin resistance. After 6–7 h of incubation at 37 °C and shaking at 220 rpm (thermostatic oscillator, Taicang, China), the sequence of the correct bacterial solution was transferred to 300 mL LB medium containing ampicillin resistance with a 0.5% inoculation amount. After 16 h of shaking the culture at 37 °C and 220 rpm (thermostatic oscillator), stable transfection plasmids were prepared with a Nucleo Bond Xtra Midi Plus EF (MN) kit (Macherey–Nagel, Düren, Germany). The recombinant plasmid was transfected into Chinese hamster ovary (CHO)-K1 cells with a neon electrophoresis apparatus under the conditions of 1400 V, 20 ms and 2 pulses. Subsequent to transfection, the cells were incubated in 5 mL 4 mmol/L Gln-containing Dynamis (Gibco) medium that was preheated to 37 °C for two days. They were then inoculated in 96-well plates at 5000 cells/well for three weeks. The cells were screened with 50 μmol/L l -methionine sulfoximine (MSX, Sigma–Aldrich, St. Louis, MO, USA) at 37 °C and cultured in a 7% CO 2 incubator for 3 weeks. The highly expressed clones that were grown in 96-well plates were subcultured from 96-well plates to 24-well stationary plates, and then were cultured again in 24-well plates. The volume of each hole was 2 mL, and the culture medium was Dynamis + 25 μmol/L MSX. The culture conditions were 37 °C, 5% CO 2 , and 220 rpm (thermostatic oscillator). Cells in the 24 deep-hole plates were diluted for 2–4 passages at a density of 0.3–0.5 × 10 6 /mL until the clones adapted to the suspension culture. The clones with the highest expression levels were selected for production and preparation of protein samples. Cells were inoculated in 1 L Dynamis medium at a density of 0.5 × 10 6 /mL. The cells were fed batch culture for 14 days on a shaking bed of 37 °C, 5% CO 2 and 130 rpm (thermostatic oscillator). On the third day, the temperature was dropped to 34 °C, and on the third, fifth, seventh and tenth days, the cells were fed with 2 × CD Efficient Feed C + (Gibco) at 5%, 5%, 8% and 8% of the culture volume, respectively. On the seventh and tenth days, sugar was added at 3 g/L after nova detection and then the cells were harvested for 14 days. After centrifugation for 15 min, the supernatant was collected and filtered through a 0.45 μm membrane to collect the filtrate. The target protein was an Fc fusion protein, which could be captured by specific adsorption of an Fc fragment with the affinity filler Prosep Ultra Plus (Millipore, Burlington, Massachusetts, USA). First, the column was balanced with a three-fold column volume equilibrium solution, phosphate buffered saline (PBS, Sigma–Aldrich) at pH 7.0. After balancing, the retention time of the sample was controlled between 1 and 2 min according to the actual pressure of the column. After sampling, the column was washed with a five-fold column volume equilibrium solution. The protein sample was eluted with 50 mmol/L NaAc–HAc (Sigma–Aldrich), pH 3.6 buffer solution, and the retention time was controlled at 3 min. The ultraviolet (UV) value was observed for collection. Protein samples were quantified by 3 mol/L Tris (Sigma–Aldrich) with pH ranging from 6.0 to 7.0. Ultrafiltration membranes with a pore size of 30 kD and membrane area of 0.14 m 2 were selected. The membrane was coated with 50 mmol/L phosphate buffer (PB, Sigma–Aldrich) and the displacement solution was pH 6.6. The pH in tank was the same as that in the displacement solution. The filter end was closed and the sample was slowly poured into the tank. The sample was recycled. After the concentration of the sample was stable, the filter end was opened, the volume concentration was controlled to the theoretical volume, and the filter end was closed for internal circulation. When the concentration was stable, the inlet and outlet were opened and the speed of the inlet and outlet was adjusted until a stable volume remained unchanged. After 10 volume changes, closing the inlet and outlet, and concentrating the sample to a certain volume, the outlet was closed. The internal circulation lasted for 30 min. After the internal circulation, the reflux end was opened to collect samples. A certain volume of displacement solution was poured in, the ultrafiltration equipment was washed, and the sample was collected. The final sample system was 50 mmol/L PB and 6% sucrose (Sigma–Aldrich) and the pH was 6.6. The protein was then quantified. A filter-aided sample preparation (FASP) 15 method was employed for enzymatic hydrolysis to obtain three final products. A total of 200 μg of proteins were combined with 30 μL SDT buffer [4% sodium dodecyl sulfonate (SDS, Sigma–Aldrich), 100 mmol/L dithiothreitol (DTT, Sigma–Aldrich), 150 mmol/L Tris–HCl (Sigma–Aldrich) pH 8.0]. Using repeated ultrafiltration (Microcon units, 10 kD), DTT, the detergent, and other low-molecular-weight components were removed with UA buffer (8 mol/L Urea, 150 mmol/L Tris–HCl pH 8.0). Next, 100 μL of 100 mmol/L iodoacetamide (IAM, Sigma–Aldrich) in UA buffer were added to block the reduced cysteine residues and the samples were then incubated in darkness for 30 min. The filters were washed three times with 100 μL UA buffer and then twice with 100 μL 25 mmol/L NH 4 HCO 3 (Sigma–Aldrich) buffer. Finally, 4 μg of trypsin (Promega, Madison, WI, USA) in 40 μL 25 mmol/L NH 4 HCO 3 buffer were used to digest the protein suspensions overnight at 37 °C. The resulting peptides were then obtained as a filtrate. The peptides from each sample were desalted on C18 Cartridges [Empore™ SPE Cartridges C18 (standard density), volume 3 mL, bed I.D. 7 mm, Sigma–Aldrich], concentrated with vacuum centrifugation and then reconstituted in 40 μL of 0.1% ( v / v ) formic acid. The peptide content was estimated using UV light spectral density at 280 nm with an extinction coefficient of 1.1 of a 0.1% ( w / v ) solution that was calculated based on the frequency of tyrosine and tryptophan in vertebrate proteins. A Q Exactive mass spectrometer (Thermo Fisher Scientific, Waltham, MA, USA) that was coupled to an Easy nLC (Proxeon Biosystems, Odense, Denmark) was used for LC–MS/MS analysis for 60 min, which was set in the project proposal 16 . The positive ion mode was used in the mass spectrometer. MS data were obtained using a data-dependent top10 method while the most abundant precursor ions were dynamically chosen from the survey scan (300–1800  m / z ) for high energy collision induced dissociation (HCD) fragmentation. The maximum inject time was set at 10 ms and the automatic gain control (AGC) target was set at 3e6. The duration of dynamic exclusion was 40 s. The survey scans were acquired at m /z 200 at a resolution of 70,000. The resolution for the HCD spectra was set at m / z 200 at 17,500. The isolation width was set at 2  m / z and the normalized collision energy was set at 30 eV. The underfill ratio was defined as 0.1%, which specified the likely minimum percentage of the target value at maximum fill time. The peptide recognition mode was set at Enabled. MaxQuant software version 1.5.3.17 (Max Planck Institute of Biochemistry in Martinsried, Germany) 17 was used for analysis of the MS data. The target protein sequence database was searched to recognize MS data. The initial search setting was a precursor mass window of 6 ppm. The search employed the enzymatic cleavage rule of Trypsin/P and two missed cleavage sites were maximally allowed. A mass tolerance of 20 ppm was set for fragment ions: missed cleavage = 2, enzyme = trypsin, fixed variable modification was oxidation (M), modification was carbamidomethyl (C), and the decoy database pattern was reverse. A cutoff of 0.01 was used for the global false discovery rate (FDR) for protein and peptide identification 18 . Cells (20 μL, 10,000/well) were grown with complete medium in 384-well plates to create a CHO-K1/GnRHR/G α 15 stable cell line (Genscript, Nanjing, China). After overnight incubation at 37 °C/5% CO 2 , we added 20 μL/well dye and 10 μL/well gonadorelin or LMRAP (five-fold dilution, eight concentrations in triplicate) and then incubated the cells for 1 h. The plate was equilibrated at RT for 15 min and the fluorescence was detected using fluorescence image plate reader (FLIPR) Tetra (Molecular Devices, Los Angeles, CA, USA) 19 . A positive antagonist was used as the reference compound for sample concentration determination. A transwell invasion assay using Boyden chambers (BD Biosciences, Franklin Lakes, NJ, USA) with 8-μm pore size membranes coated with Matrigel was used to evaluate the cell invasive ability 20 . Human umbilical vein endothelial cells (HUVECs) were placed into the upper chamber of an insert in serum-free media. Media with 10% FBS was added to the lower chamber. The cells that had invaded through the membrane after several hours of incubation were stained with methanol and 0.1% crystal violet. They were then imaged and counted under a microscope in random fields at 100× magnification in each well. The mRNA levels of GnRHR-I , α5β1 , and αvβ3 were measured via real-time PCR. Trizol reagents (Thermo Fisher Scientific) were used for isolating the total RNA from cancer cells according to the manufacturer's instructions. Cancer cell RNA (1 μg) was used in complementary deoxyribonucleic acid (cDNA) synthesis with reverse transcription reagent (Transgen Biotech). cDNA (125 ng) was added to the real-time PCR reaction along with glyceraldehyde 3-phosphate dehydrogenase ( GAPDH ). Primer Premier version 6.0 software (PREMIER Biosoft, Palo Alto, CA, USA) was used to design specific primers and they were then synthesized by Sangon Biotech (Shanghai, China). The primers were as follows: GnRHR-I (forward: 5ʹ-GTGTCTTTGCAGGACCACAG-3ʹ; reverse: 5ʹ-GCCACCATTGTGAAAAACTGC-3ʹ), α5 (forward: 5ʹ-TGGCCTTCGGTTTACAGTCC-3ʹ; reverse: 5ʹ-GGAGAGCCGAAAGGAAACCA-3ʹ), β1 (forward: 5ʹ-GCCGCGCGGAAAAGATG-3ʹ; reverse: 5ʹ-ACAATTTGGCCCTGCTTGTA-3ʹ), αv (forward: 5ʹ-GACTCCTGCTACCTCTGTGC-3ʹ; reverse: 5ʹ-CGAAGAAATCCACGGCGAAG-3ʹ), β3 (forward: 5ʹ-CGAGTGCCTCTGTGGTCAAT-3ʹ; reverse: 5ʹ-AGAAGTCGTCACACTCGCAG-3ʹ), and the internal control GAPDH (forward: 5ʹ-GGTTGTCTCCTGCGACTTCA-3ʹ; reverse: 5ʹ-TGGTCCAGGGTTTCTTACTCC-3ʹ). A SYBR Real-time PCR Master Mix kit (TOYOBO, Osaka, Japan) was used to amplify messenger ribonucleic acid (mRNA) according to the manufacturer's protocol. The amplification reactions were carried out on an ABI 7500 real-time PCR system (Applied Biosystems, Foster City, CA, USA). The mRNA levels of the target genes for each experimental group were determined from the 2 −ΔΔCt value. Each reaction had three replicates per group. Cellular extracts were prepared by radioimmunoprecipitation assay (RIPA) lysis buffer, and protein concentrations were quantified by Bradford assays (Bio-Rad Laboratories, Hercules, CA, USA). We electrophoresed a total of 40 μg protein through 12% sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE, Bio-Rad Laboratories) gels and electro-transferred it onto polyvinylidene fluoride (PVDF, Bio-Rad Laboratories) membranes. After being blocked with 5% skim milk, membranes were incubated with primary antibodies recognizing mouse anti-human α v β 3 (1:1000; Abcam, Cambridge, UK), rabbit anti-human GnRHR-I, rabbit anti-human α 5 β 1, rabbit anti-human GAPDH (1:1000, EnoGene) and horseradish peroxide (HRP)-conjugated secondary antibody (1:5000, EnoGene). The immunoreactivity of bands was developed using an electrochemiluminescence (ECL) detection system (Thermo Fisher Scientific). Membranes were scanned and analyzed using an ImageQuant LAS 4000 Chemiluminescence Imaging System (GE Healthcare, Chicago, IL, USA). A cell counting kit (CCK)-8 (EnoGene) was used to assess cell proliferation 21 . Briefly, cells were plated in 96-well plates at a density of 1 × 10 4  cells/well and were allowed to adhere overnight in a humidified atmosphere of 5% CO 2 at 37 °C. Cells were incubated in a series of diluted concentrations of LMRAP. Cytotoxicity was measured by CCK-8 dye coloration after 72 h incubation. A total of 10 μL CCK-8 were added to each well. The plates were then incubated at 37 °C for 4 h. The absorbance was measured at 450 nm with a microplate reader (Thermo Fisher Scientific). The IC 50 values were calculated with GraphPad Prism software (San Diego, CA, USA) and four-parameter curve fitting was employed. All experiments were carried out in six duplicates. LMRAP antitumor activity was assessed in a human prostate carcinoma model by employing the 22RV1 human prostate cancer cell line 22 . The site's Institutional Animal Care and Use Committee approved the experimental protocol. In this experiment, BALB/c nude male mice that were 6–8 weeks old were implanted in the right flank subcutaneously with 5 × 10 6 22RV1 tumor cells. Animals ( n  = 8 per group, n  = 16 in model group) were randomized for a tumor volume of 80–100 mm 3  at 15 days after tumor cell implantation. Animals received a tail vein injection (i.v.) of LMRAP at 12.5, 25, and 50 mg/kg for two weeks, a tail vein injection of AP25 at 20 mg/kg for two weeks, and a muscle injection (i.m.) of gonadorelin at 65 μg/kg for two weeks, AP25 20 mg/kg (i.v.) combined with gonadorelin 65 μg/kg (i.m.) for two weeks or tail vein injection (i.v.) of avastin 20 mg/kg on day 1 and day 8. Tumor size was measured every other day with digital calipers and the formula volume (mm 3 ) = length × width 2 /2 was used for calculations. The mice were sacrificed at the end of the study by placing them in a CO 2 gas-filled chamber. The excised tumors were then recovered and weighed. Histological sections from formalin fixed paraffin embedded (FFPE) xenograft tumors were used. IHC was applied to detect Cluster of differentiation 31 (CD31) and Cluster of differentiation 34 (CD34) expressions. IHC staining was performed with CD31 antibodies (EnoGene) and CD34 antibodies (EnoGene) at a 1:100 dilution. Immunostaining was carried out using routine methods. Positive signals of CD34 and CD31 were on the cell membrane. We evaluated the intensity of staining with a scale as previously described. The results were assessed using the following categories: staining intensity of null (0), weak (1+), moderate (2+), and strong (3+). Two experienced pathologists judged all IHC staining results independently. The dosage of tail intravenous administration of LMRAP in SD rats (3 females and 3 males) was 12.5 mg/kg. All procedures were approved by the Institutional Ethical Review Committees and conducted under the authority of the Project License. The experimental sampling time points were: SD rats at 5 min before administration and then 0, 5, 10, 30 min, 1, 2, 4, 6, 8, 12, 24, 36, 48, 72, 96, 120, 144, 168, 192, and 216 h after LMRAP administration. The animal weights were recorded. Eye frame blood was collected and the supernatant was centrifuged. Each serum sample of 100–200 μL was stored in an eppendorf (EP) tube at −80 °C. Sampling times were clearly marked. The standard sample was diluted to a certain concentration gradient with the mixed solution of blank SD rat plasma and PBS. An indirect competitive ELISA was performed and the standard curve was made 23 . The optical density (OD) 450 nm values of standard samples with different concentration gradients were recorded as B , and the OD 450 nm values of standard samples without concentration gradients were recorded as B 0 . ELISA Calc software (Customized Applications Inc., Chicago Heights, IL, USA) was used to fit the logit–log linear regression and establish the standard curve. The fitting equation was: let P  =  B / B 0 , q  = 1− p , y  = ln( p / q ), and x  = lg( C ), then the equation was y  =  a + b  ×  X . The results were processed with pharmacokinetic software drug and statistics (DAS) 1.0 (Mathematical Pharmacology Professional Committee of China, Shanghai, China), ELISA Calc (Customized Applications, Inc.), statistic package for social science (SPSS) package (SPSS Inc., Chicago, IL, USA). The OD value ( n  < 3) was calculated with ELISA Calc software and then pharmacokinetic parameters were calculated with DAS 1.0 software. To determine the MTD, 10 male and 10 female BALB/c mice were randomly assigned to the study. The animals received dose formulations containing LMRAP at various dosages via i.v. injection for a single dose in one day. If no obvious toxicity was observed for the single dose, the animals received dose formulations containing LMRAP at various dosages via i.v. injection three times a day. The MTD in this study was defined as the highest dose that was tolerated and that did not produce major life-threatening toxicity in the 14-day study duration 24 . The data are shown as the mean ± standard deviation. The significance of the results obtained from both groups was evaluated with a Student's unpaired t -test and one way analysis of variance (ANOVA). All statistical analyses were performed with SPSS 18.0 (SPSS, Inc.). A difference was considered statistically significant with a two-tailed P value less than 0.05. P  < 0.01 was considered to designate a highly significant difference between the values.

Discussion

Prostate cancer accounts for one-fifth of new cancer diagnoses and it is the third leading cause of cancer death in the United States 25 , 26 . Androgen deprivation therapy is indicated for use in multiple clinical settings for advanced prostate cancer, which includes chemical castration consisting of GnRH agonists and antagonists 27 . One of the main concerns when using GnRH agonists, such as goserelin or gonadorelin, is a testosterone surge caused by initial stimulation of the pituitary gland, which may lead to a tumor flare, a rapid expansion of the prostate cancer, leading to pain and potential debilitation in patients, specifically with spinal metastases 28 . The GnRH agonists generated considerable side-effects including hot flashes, impotence, accelerated bone resorption, loss of muscle mass, loss of libido and, in some instances, profound psychologic effects 29 . An immunological approach to achieve androgen deprivation to treat prostate cancer, such as LHRH vaccinations, had also been tested in men 30 . Passive immunization, that is, infusion of anti-LHRH antibodies that neutralized the action of LHRH/GnRH through the involvement of hormone-specific antibodies, has been demonstrated in many animal species 6 . The GnRH–tetanic toxoid conjugates, due to their large size, can induce anti-haptenic immunosuppression; however, this is difficult to reproduce on an industrial scale 31 . Studies have reported that the administration of either polyvalent or monoclonal anti-GnRH antibodies in males leads to cessation of spermatogenesis, decreased testicular size, and a severe reduction of testosterone levels, as does immunization with GnRH-carrier conjugates 32 , 33 . Angiogenesis is an important process that occurs in both physiological and pathological conditions. It has been shown that angiogenesis affects the behavior and biology of various neoplastic and non-neoplastic diseases 34 , 35 . Angiogenesis plays a crucial role in prostate cancer survival, progression, and metastasis 36 , 37 , 38 . It is a complicated process that depends on the balance between inhibitors and activators of angiogenesis 39 . Vascular endothelial growth factor (VEGF) and several neurosecretory peptides, such as bombesin and gastrin, are known to promote angiogenesis in prostate cancer 40 . Bifunctional molecules that have been classified as novel therapeutics have been shown to have multifunctional properties 41 . A fusion protein with two or more domains genetically fused together might have improved product stability. This might help with the acquisition of biological activity 42 . AP25 is an anti-angiogenic and anti-tumor peptide with molecular targets, including integrin α 5 β 1 and α v β 3. AP25 contains the sequence ES-2 and this sequence is included in one of the two active domains of endostatin. It induces the inhibitory effect of endostatin on angiogenesis 43 . GnRH is a hypothalamic decapeptide gonadotropin releasing hormone that binds to the GnRHR that is expressed in cancer cells, such as prostate cancer cells. The Fc fragment is part of the constant region heavy chain 2 (C H 2) and constant region heavy chain 3 (C H 3) functional region of IgG, and it can improve the stability and prolong the plasma half-life of a fusion protein. This is due to depressed kidney filtration and degradation prevention when binding to neonatal Fc receptor (FcRn) 44 , 45 . However, direct fusion of various functional domains may cause misfolding of fusion protein spatial structures, lower potency or inefficient expression 12 , 13 , 14 . To maintain domain function, the choice of a peptide linker in the design for bifunctional fusion is quite significant. Efficacy in the fusion protein domain separation is influenced by linker sequence flexibility. The linker GGGGSGGGGSGGGGS 46 , comprising small size amino acids (Gly, Ser), provides enhanced flexibility and mobility of the connecting functional domains to expose binding areas and avoid the coated Fc fragment, which promotes effective targeting. LMRAP is an Fc fusion protein produced by the fusion of functional proteins with GnRH Fc fragments and the AP25 peptide using genetic engineering technology. The Fc segment in molecular design originates from IgG4 and has a weak antibody dependent cellular cytotoxicity (ADCC) effect 47 . The fusion protein not only retains the biological activity of the functional proteins, but also prolongs the half-life, reduces glomerular clearance and avoids lysosome hydrolysis in cells. Fusion protein characteristics are influenced in various ways by the flexibility of the linker sequence 48 . Our study showed that in the sequence of LMRAP, GnRH-linker-hIgG4 Fc-linker-AP25 had the best activity compared with the sequence of LMRAP-A, AP25-linker-hIgG4 Fc-linker-GnRH and the sequence of LMRAP-B, AP25-linker-GnRH-linker-hIgG4 Fc. LMRAP not only significantly inhibited the invasion activity of HUVECs, but also significantly inhibited GnRHR-I positive cell viability in human prostate cancers 22RV1 and PC-3, human ovarian cancer SKOV3, and A2780 cells in vitro . The IC 50 for LMRAP in GnRH receptors was 6.235 × 10 −4  mol/L by antagonist assay. In prostate cancer cells, GnRHR signaling includes activation of phosphoinositide (PI) and Gi turnover 49 . This signaling could further activate protein kinase C (PKC) and result in negative transmodulation of epidermal growth factor receptor (EGFR) due to Thr654 phosphorylation, which is known to downregulate EGFR and inhibit its signaling 50 . In addition, GnRH reduced cyclic adenosine monophosphate (cAMP) levels and EGF binding sites in prostate cancer cells 51 . LMRAP significantly inhibited human prostate cancer cell line 22RV1 proliferation in vivo , which is consistent with the in vitro study. This may be caused partly by GnRH receptor blocking. To further investigate whether LMRAP inhibited angiogenesis, microvessel density (MVD) using various endothelial cell markers including CD34 and CD31 were assessed. CD34 is a 110-kDa cell surface glycoprotein and it functions as a cell–cell adhesion factor. It mediates the attachment of stem cells to stromal cells or the bone marrow extracellular matrix. CD31, a 130-kDa glycoprotein, is found on the surface of blood endothelial cells, platelets, lymphocytes, and macrophages. Both CD31 and CD34 can be used to demonstrate the presence of endothelial cells in histological tissue sections to assess tumor angiogenesis 52 . Our study showed that LMRAP significantly inhibited both CD31 and CD34 expression in prostate cancer xenografted tumor tissues, which further confirmed that LMRAP had bifunctional properties. The study of LMRAP pharmacokinetic characteristics in the plasma of SD rats indicated that the elimination half-life of fusion protein LMRAP was prolonged to 33 h compared with the polypeptide AP-25 having an elimination half-life of 55 min. Gonadorelin is not a cytotoxic drug and it cannot directly produce anti-tumor effects in terms of its mechanism of action. In molecular mechanism designs, we introduced the polypeptide AP25, which has anti-tumor effects. Therefore, in this study, the anti-prostate cancer effect of the fusion protein is mainly produced by AP25. Because of the addition of the Gonadorelin domain to the fusion protein, the fusion protein has the additional potential function of regulating the release of the gonadal axis hormone. In addition to the improved pharmacokinetic characteristics, LMRAP was also well tolerated in mice based on the absence of clinical side effects in all animals, minimal body weight and animal activities. The MTD was 307.2 times of the pharmacodynamic dose, which indicated that LMRAP had a good safety performance.

Conclusions

A new strategy for GnRH expressing cancers was developed by fusing the GnRH Fc fragment and the integrin targeting AP25 antitumor peptide. The fusion protein not only retained the bifunctional biological activity of GnRH receptor blocking and angiogenesis inhibition, but also prolonged the half-life, which provides a reliable basis for the later pre-clinical research. The clinical effect of the fusion protein may have better potential as a therapeutic agent.

Introduction

Hypothalamic decapeptide gonadotropin releasing hormone (GnRH), sometimes called luteinizing hormone-releasing hormone (LHRH), has an important role in mammalian reproduction regulation 1 . It has been shown that 86% of human prostate adenocarcinomas have high-affinity binding sites for GnRH. The GnRH receptor (GnRHR) has been detected at lower levels in the normal prostate compared to prostate cancer specimens. Some normal human prostate cell lines have no GnRH signaling 2 . Higher Gleason score tumors have fewer receptor numbers, but have higher affinity receptors 3 . In addition to prostate cancer, breast, endometrial, ovarian, pancreatic and hepatoma cancers, as well as endometrial cells in endometriosis, have cells that express GnRHR 4 . About 50% of breast cancers and 80% of endometrial cancers express both GnRH and GnRHR within the autocrine system 5 . The neutralizing effect of LHRH/GnRH with hormone-specific antibodies has been established in a wide range of species. Some studies have used passive immunization based on infusion of anti-LHRH antibodies 6 . GnRH vaccines have also been promising for managing hormone-dependent breast and prostate cancers 7 , 8 , 9 . However, the use of these vaccines clinically requires powerful adjuvant therapy to enhance antibody responses that could effectively block hormone–receptor binding 10 . AP25 is a polypeptide that was designed in our laboratory by modifying an endostatin-derived peptide fragment, which was a 25-amino-acid arginine-glycine-aspartic acid (RGD)-modified polypeptide targeting α v β 3 and α 5 β 1 integrins expressed in endothelial and tumor cells. Previous in vivo and in vitro experiments have indicated that this integrin antagonist peptide has an extraordinary antitumor effect on different types of cancer 11 . In this study, we developed a new strategy for GnRH receptor-expressing cancers by fusion of a GnRH Fc (fragment crystallizable) fragment and the AP25 antitumor peptide. The design idea was to maintain the antitumor epitope and activity of both AP25 and the GnRH Fc fragment. The direct fusion of functional domains may lead to misfolding of a product 12 , a low yield 13 , or impaired bioactivity or half-life 14 . The choice of a peptide linker that has the ability to maintain the domain function in the design of a bifunctional fusion protein is essential for maintaining bioactive molecules with an enhanced effect. By choosing a suitable peptide linker (flexible linker) and optimizing the structure of the fusion protein, we hypothesized that the bifunctional fusion protein may possess functions derived from each of their component moieties and this may achieve enhanced therapeutic effects.

Acknowledgments

The subject of the National Science and Technology Major Projects for Major New Drugs Innovation and Development supported this study (grant No. 2018ZX09736016-007, China).

Text is read by the "Ask this paper" AI Q&A widget below. Extraction quality varies by source — PMC NXML preserves structure cleanly, OA-HTML may include some navigation residue, and OA-PDF can have broken hyphenation. The publisher copy (via DOI) is the canonical version.

My notes (saved in your browser only)

Ask this paper AI returns verbatim quotes from the full text · source: pmc-nxml

Answers must be backed by verbatim quotes from this paper's full text. Hallucinated quotes are dropped automatically; if no verbatim passage answers the question, we say so. How this works

Citation neighborhood (no data yet)

We don't have any in-corpus citations linked to this paper yet. The paper's references may be in our DB but unresolved to ``paper_id`` (resolution happens at ingest when the cited DOI matches a row we already have). Run the cross-source citation reconcile pass to retry.

Source provenance

europepmc
last seen: 2026-08-30T09:23:35.175841+00:00
unpaywall
last seen: 2026-05-21T05:10:58.409756+00:00
License: CC-BY-NC-ND-4.0