Structural Insights into the Dynamics of Water in SOD1 Catalysis and Drug Interactions

preprint OA: closed
📄 Open PDF Full text JSON View at publisher

Abstract

Superoxide dismutase 1 (SOD1) is a crucial enzyme that protects cells from oxidative damage by converting superoxide radicals into H 2 O 2 and O 2 . This detoxification process, essential for cellular homeostasis, relies on a precisely orchestrated catalytic mechanism involving the copper cation, while the zinc cation contributes to the structural integrity of the enzyme. This study presents the 2.3 Å crystal structure of human SOD1 (PDB ID: 9IYK), revealing an assembly of six homodimers and twelve distinct active sites. The water molecules form a complex hydrogen-bonding network that drives proton transfer and sustains active site dynamics. Our structure also uncovers subtle conformational changes that highlight the intrinsic flexibility of SOD1, which is essential for its function. Additionally, we observe how these dynamic structural features may be linked to pathological mutations associated with amyotrophic lateral sclerosis (ALS). By advancing our understanding of hSOD1’s mechanistic intricacies and the influence of water coordination, this study offers valuable insights for developing therapeutic strategies targeting ALS. Our structure’s unique conformations and active site interactions illuminates new facets of hSOD1 function, underscoring the critical role of structural dynamics in enzyme catalysis. Besides, we conducted molecular docking analysis using SOD1 for potential radical scavengers and Abl1 inhibitors targeting misfolded SOD1 aggregation along with oxidative stress and apoptosis, respectively. The results showed that CHEMBL1075867, a free radical scavenger derivative, showed the most promising docking results and interactions in the binding site of hSOD1, highlighting its promising role for further studies against SOD1-mediated ALS.
Full text 93,666 characters · extracted from preprint-html · click to expand
Structural Insights into the Dynamics of Water in SOD1 Catalysis and Drug Interactions | bioRxiv /* */ /* */ <!-- <!-- /*! * yepnope1.5.4 * (c) WTFPL, GPLv2 */ (function(a,b,c){function d(a){return"[object Function]"==o.call(a)}function e(a){return"string"==typeof a}function f(){}function g(a){return!a||"loaded"==a||"complete"==a||"uninitialized"==a}function h(){var a=p.shift();q=1,a?a.t?m(function(){("c"==a.t?B.injectCss:B.injectJs)(a.s,0,a.a,a.x,a.e,1)},0):(a(),h()):q=0}function i(a,c,d,e,f,i,j){function k(b){if(!o&&g(l.readyState)&&(u.r=o=1,!q&&h(),l.onload=l.onreadystatechange=null,b)){"img"!=a&&m(function(){t.removeChild(l)},50);for(var d in y[c])y[c].hasOwnProperty(d)&&y[c][d].onload()}}var j=j||B.errorTimeout,l=b.createElement(a),o=0,r=0,u={t:d,s:c,e:f,a:i,x:j};1===y[c]&&(r=1,y[c]=[]),"object"==a?l.data=c:(l.src=c,l.type=a),l.width=l.height="0",l.onerror=l.onload=l.onreadystatechange=function(){k.call(this,r)},p.splice(e,0,u),"img"!=a&&(r||2===y[c]?(t.insertBefore(l,s?null:n),m(k,j)):y[c].push(l))}function j(a,b,c,d,f){return q=0,b=b||"j",e(a)?i("c"==b?v:u,a,b,this.i++,c,d,f):(p.splice(this.i++,0,a),1==p.length&&h()),this}function k(){var a=B;return a.loader={load:j,i:0},a}var l=b.documentElement,m=a.setTimeout,n=b.getElementsByTagName("script")[0],o={}.toString,p=[],q=0,r="MozAppearance"in l.style,s=r&&!!b.createRange().compareNode,t=s?l:n.parentNode,l=a.opera&&"[object Opera]"==o.call(a.opera),l=!!b.attachEvent&&!l,u=r?"object":l?"script":"img",v=l?"script":u,w=Array.isArray||function(a){return"[object Array]"==o.call(a)},x=[],y={},z={timeout:function(a,b){return b.length&&(a.timeout=b[0]),a}},A,B;B=function(a){function b(a){var a=a.split("!"),b=x.length,c=a.pop(),d=a.length,c={url:c,origUrl:c,prefixes:a},e,f,g;for(f=0;f<d;f++)g=a[f].split("="),(e=z[g.shift()])&&(c=e(c,g));for(f=0;f<b;f++)c=x[f](c);return c}function g(a,e,f,g,h){var i=b(a),j=i.autoCallback;i.url.split(".").pop().split("?").shift(),i.bypass||(e&&(e=d(e)?e:e[a]||e[g]||e[a.split("/").pop().split("?")[0]]),i.instead?i.instead(a,e,f,g,h):(y[i.url]?i.noexec=!0:y[i.url]=1,f.load(i.url,i.forceCSS||!i.forceJS&&"css"==i.url.split(".").pop().split("?").shift()?"c":c,i.noexec,i.attrs,i.timeout),(d(e)||d(j))&&f.load(function(){k(),e&&e(i.origUrl,h,g),j&&j(i.origUrl,h,g),y[i.url]=2})))}function h(a,b){function c(a,c){if(a){if(e(a))c||(j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}),g(a,j,b,0,h);else if(Object(a)===a)for(n in m=function(){var b=0,c;for(c in a)a.hasOwnProperty(c)&&b++;return b}(),a)a.hasOwnProperty(n)&&(!c&&!--m&&(d(j)?j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}:j[n]=function(a){return function(){var b=[].slice.call(arguments);a&&a.apply(this,b),l()}}(k[n])),g(a[n],j,b,n,h))}else!c&&l()}var h=!!a.test,i=a.load||a.both,j=a.callback||f,k=j,l=a.complete||f,m,n;c(h?a.yep:a.nope,!!i),i&&c(i)}var i,j,l=this.yepnope.loader;if(e(a))g(a,0,l,0);else if(w(a))for(i=0;i (function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0];var j=d.createElement(s);var dl=l!='dataLayer'?'&l='+l:'';j.src='//www.googletagmanager.com/gtm.js?id='+i+dl;j.type='text/javascript';j.async=true;f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-M677548'); Skip to main content Home About Submit ALERTS / RSS Search for this keyword Advanced Search New Results Structural Insights into the Dynamics of Water in SOD1 Catalysis and Drug Interactions View ORCID Profile Ilkin Yapici , View ORCID Profile Arda Gorkem Tokur , View ORCID Profile Belgin Sever , View ORCID Profile Halilibrahim Ciftci , Ayse Nazli Basak , View ORCID Profile Hasan DeMirci doi: https://doi.org/10.1101/2025.02.18.638811 Ilkin Yapici 1 Department of Molecular Biology and Genetics, Koc University , Istanbul 34450, Türkiye Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Ilkin Yapici Arda Gorkem Tokur 1 Department of Molecular Biology and Genetics, Koc University , Istanbul 34450, Türkiye Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Arda Gorkem Tokur Belgin Sever 2 Department of Pharmaceutical Chemistry, Faculty of Pharmacy, Anadolu University , Eskisehir 26470, Türkiye Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Belgin Sever Halilibrahim Ciftci 3 Department of Molecular Biology and Genetics, Burdur Mehmet Akif Ersoy University , Burdur 15030, Türkiye Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Halilibrahim Ciftci Ayse Nazli Basak 4 Suna and İnan Kıraç Foundation, Neurodegeneration Research Laboratory (KUTTAM-NDAL), School of Medicine, Koc University , Istanbul 34450, Türkiye Find this author on Google Scholar Find this author on PubMed Search for this author on this site For correspondence: hdemirci{at}ku.edu.tr nbasak{at}ku.edu.tr Hasan DeMirci 1 Department of Molecular Biology and Genetics, Koc University , Istanbul 34450, Türkiye 5 Stanford PULSE Institute, SLAC National Laboratory , 94025, Menlo Park, CA, USA Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Hasan DeMirci For correspondence: hdemirci{at}ku.edu.tr nbasak{at}ku.edu.tr Abstract Full Text Info/History Metrics Supplementary material Preview PDF Abstract Superoxide dismutase 1 (SOD1) is a crucial enzyme that protects cells from oxidative damage by converting superoxide radicals into H 2 O 2 and O 2 . This detoxification process, essential for cellular homeostasis, relies on a precisely orchestrated catalytic mechanism involving the copper cation, while the zinc cation contributes to the structural integrity of the enzyme. This study presents the 2.3 Å crystal structure of human SOD1 (PDB ID: 9IYK), revealing an assembly of six homodimers and twelve distinct active sites. The water molecules form a complex hydrogen-bonding network that drives proton transfer and sustains active site dynamics. Our structure also uncovers subtle conformational changes that highlight the intrinsic flexibility of SOD1, which is essential for its function. Additionally, we observe how these dynamic structural features may be linked to pathological mutations associated with amyotrophic lateral sclerosis (ALS). By advancing our understanding of hSOD1’s mechanistic intricacies and the influence of water coordination, this study offers valuable insights for developing therapeutic strategies targeting ALS. Our structure’s unique conformations and active site interactions illuminates new facets of hSOD1 function, underscoring the critical role of structural dynamics in enzyme catalysis. Besides, we conducted molecular docking analysis using SOD1 for potential radical scavengers and Abl1 inhibitors targeting misfolded SOD1 aggregation along with oxidative stress and apoptosis, respectively. The results showed that CHEMBL1075867, a free radical scavenger derivative, showed the most promising docking results and interactions in the binding site of hSOD1, highlighting its promising role for further studies against SOD1-mediated ALS. 1. Introduction Oxidative stress, a major cause of cellular damage, occurs when cells produce superoxide (O 2 − ) radicals as a by-product of oxygen reduction during cellular respiration [ 1 ]. Cu-Zn superoxide dismutase 1 (SOD1), which catalyzes the conversion of two O 2 − anions into H 2 O 2 and O 2 , operates mainly in the cytoplasm and plays a central role as a cytoprotectant against oxidative stress [ 2 ]. By eliminating these highly reactive O 2 − species, SOD1 acts as a frontline defense in preventing oxidative damage to cellular components such as proteins, lipids, and nucleic acids [ 3 ]. Human SOD1 (hSOD1) is a highly conserved 32 kDa homodimeric metalloenzyme, with each monomer containing a zinc cation (Zn 2+ ) for structural stability and a copper cation (Cu 2+ ) for catalytic activity [ 4 ]. The imidazole ring of His63 acts as a ligand to both cations, bridging them together [ 5 , 6 ]. Zn 2+ is additionally coordinated by two histidine residues (His71 &His80) and an aspartic acid residue (Asp83), while five-coordinate Cu 2+ relies on three more histidine residues (His46, His48 & His120) and a water molecule [ 7 ]. Not only the precise coordination of the metal ions but also their dynamic interplay with key residues, O 2 − anions, and water molecules within the active site are crucial in the conversion of radicals. The well-established ping-pong reaction mechanism of hSOD1 involves the sequential reduction and reoxidation of copper by two distinct O 2 − anions [ 8 , 9 ]. Structural studies of SOD1 across various eukaryotic organisms provide additional support for this finely tuned catalytic cycle [ 6 , 10 – 13 ]. The O 2 − anion forms H bonds with the Arg143 side chain, replacing the water coordinated to Cu 2+ [ 14 , 15 ]. The reduction of Cu 2+ to Cu 1+ by the lone pair electrons of the O 2 − radical releases O 2 and breaks the bond between copper and His63, creating a tri-coordinated Cu 1+ state [ 16 ]. The now protonated histidine H-bonds with another O 2 − anion, which also interacts with Arg143. Through bond rearrangements and proton addition, H 2 O 2 is formed and Cu 1+ is oxidized back to Cu 2+ , restoring its coordination with His63 [ 10 , 17 ]. The water molecules’ coordination, positioning, and dynamic behavior within the active site channel are critical as they orchestrate the necessary proton transfer for catalysis [ 18 , 19 ]. Despite the identification of water molecules, a more comprehensive understanding of their contribution to proton transfer, metal ion coordination and overall catalytic efficiency is necessary to fully elucidate hSOD1’s function. Single-point mutations in hSOD1 are linked to its gain of neurotoxicity in amyotrophic lateral sclerosis (ALS), the third most frequent, yet still orphan, neurodegenerative disease [ 20 , 21 ]. While only ∼5-10% of ALS cases are familial, over 200 mutations in hSOD1, encoded by just 153 amino acids, are the culprit behind ∼20% of inherited and ∼1-2% of sporadic ALS [ 22 , 23 ]. These mutations frequently preserve enzymatic activity but destabilize the protein, causing it to misfold and form toxic aggregates, leading to predominantly upper and lower motor neuron degeneration [ 24 ]. Although SOD1-specific Tofersen and the two other FDA-approved drugs for ALS (edaravone and riluzole) can slow disease progression and extend survival, they are unable to reverse its course [ 25 – 27 ]. Thus, a deeper understanding of the structure-dynamics-function relationship of this scavenger protein is essential for developing next-generation therapeutic strategies that address the underlying causes of ALS, rather than merely alleviating symptoms. Phenol derivatives are known radical scavengers with hydroxyl groups directly attached to an aromatic benzene ring [ 28 ]. However, they are generally not considered as therapeutics because they have irritating, corrosive and highly toxic features [ 29 ]. To mimic the radical scavenging activity of phenol through its hydroxybenzene moiety, Mitsubishi Tanabe Pharma Corporation developed potential phenol-like radical scavengers bearing a carbonyl group that can be easily converted to a hydroxyl group by keto-enol tautomerization [ 20 , 30 ]. Among a number of compounds, edaravone ( Figure 1 ) was identified as an effective radical scavenger capable of scavenging both lipid- and water-soluble peroxyl radicals [ 20 , 30 , 31 ]. Edaravone possesses neuroprotective and anti-inflammatory effects against oxidative stress and against activated microglial cells, respectively [ 32 ]. Edaravone has been reported to improve motor functions in SOD1 G93A mutant mice and SOD1 H46R mutant rats [ 33 , 34 ]. Edaravone received FDA approval for the treatment of ALS in 2017 [ 20 ]. Download figure Open in new tab Figure 1. Potential radical scavengers (A) and Abl1 inhibitors (B) in ALS. Gallic acid, 3,4,5-trihydroxybenzoic acid, ( Figure 1 ), is a strong antioxidant and radical scavenger. Gallic acid can protect biological cells, tissues, and organs against oxidative damage caused by reactive oxygen species (ROS) [ 35 ]. Excess ROS production due to oxidation of dopamine may trigger neurodegenerative disorders. The antioxidant and neuroprotective effects of gallic acid and its derivatives have been investigated in particular in the treatment of neurodegenerative disorders such as Alzheimer’s and Parkinson’s diseases [ 36 – 40 ]. Baek et al., have also found the ability of gallic acid to interfere with the formation of SOD1 filaments that could be effective in the treatment of ALS [ 41 ]. Reactive carbonyl species (RCS) are cytotoxic products of oxidative stress that damage proteins, nucleic acids and lipids [ 42 ]. Among the subgroups of RCS, α,β-unsaturated aldehydes such as 4-hydroxy-trans-2-nonenal (4-HNE) are highly cytotoxic derivatives [ 43 ]. Since 4-HNE has been identified as a contributor to delayed neuronal death by apoptosis, compounds with 4-HNE scavenging properties have been investigated for the prevention of delayed neuronal death [ 44 , 45 ]. L-carnosine hydrazide (L-carnosine-NHNH 2 , CNN) ( Figure 1 ) has been shown to have significant 4-HNE scavenging activity and to reduce delayed neuronal death in the hippocampus [ 46 ]. Apoptosis is another potential mechanism of motor neuron death in ALS [ 47 – 49 ]. Recent studies indicated that the activation of Abelson non-receptor tyrosine kinase (c-Abl, Abl1) was detected in mutant SOD1 transgenic mice models [ 50 ]. The high levels of Abl gene expression have been reported to stimulate apoptosis in motor neurons and inflammation in astrocytes and microglia, causing neurodegeneration and neuroinflammation [ 51 – 54 ]. During oxidative stress, Abl1 overexpression causes neuronal apoptosis as it is involved in the regulation of maximal activation of p53, which stimulates growth arrest and apoptosis as a tumor suppressor in response to DNA damage [ 55 ]. Dasatinib ( Figure 1 ) showed neuroprotection in SOD1 G93A transgenic ALS mice [ 50 ], while imatinib ( Figure 1 ) showed micromolar inhibition of Abl1 phosphorylation in primary neuron cultures in response to oxidative stress [ 56 ]. Bosutinib ( Figure 1 ) also increased ALS motor neuron survival and regulated misfolded SOD1 proteins in transgenic mice [ 57 ]. In this study, we determined the high-resolution crystal structure of hSOD1 in a previously unobserved crystal form and packing, revealing an assembly of six homodimers composed of twelve monomers. The unprecedented arrangement of these dimers and their active sites offers a unique opportunity to observe how structural dynamics are modulated by the surrounding solvent environment, particularly with respect to the behavior of coordinated water molecules. These coordinated water molecules are steered into alternative conformations, positions, and coordination states within the twelve catalytic sites, creating an intricate choreography. A deeper look into the dynamics of the coordinated water molecules and the active site enhances our understanding of the catalytic mechanism of the intrinsically dynamic SOD1. By capturing this dynamic water-mediated choreography, our structure provides fresh insights into how small conformational changes in hSOD1 can influence its overall function and stability, directly relevant to its role in ALS. In addition, to determine the affinity and possible binding modes to the hSOD1, we have performed molecular modelling studies for radical scavengers (edaravone, gallic acid and CNN) and Abl1 inhibitors (dasatinib, imatinib and bosutinib) and their derivatives in the binding site of hSOD1 (PDB ID: 9IYK).. 2. Results 2.1. Crystal structure of hSOD1 in a new crystal form Using X-ray synchrotron cryocrystallography, we determined the crystal structure of recombinant wild-type hSOD1 (Please see materials and methods section 4.1 for sequence informaation) at a 2.3 Å resolution in the monoclinic C121 space group, with unit cell parameters a =178.19 Å, b =138.25 Å, c =112.93 Å, α =90°, β =129.2°, γ =90°. The data collection and refinement statistics are summarized in Table 1 . The asymmetric unit of the crystal consists of six hSOD1 homodimers (A-B, C-D, E-F, G-H, I-J, and K-L chains), comprising twelve independently refined monomers ( Figure 2A ). The electron densities of chains B and D allowed the modeling of 156 residues. The remaining monomers were modeled with 153 residues, except for chains G and K, which lack the density of N-terminal alanine. A total of seventyfive alternative side-chain conformations were built into the overall model. In addition to one Zn 2+ and one Cu 2+ cation per monomer in the metal-binding sites and a total of 503 water molecules, the final model also includes four sulfate and four acetate anions originating from the crystallization mother liquor ( Figure 2C ). Download figure Open in new tab Figure 2. A) The cartoon and semi-transparent surface representations of the hSOD1 crystal structure (PDB ID: 9IYK) display an asymmetric unit consisting of six dimers and twelve monomers. Each chain is colored differently as indicated in the panel and the coloring is consistent throughout the manuscript. B) The B-factors of the hSOD1 structure are represented using ellipsoids colored in a rainbow spectrum with blue color indicating the minimum value of 20.040 and red representing the maximum value of 204.990. The hSOD1 structure exhibits a gradient from the rigid core to the periphery (especially chains H & J), where the structure becomes more flexible. C) The close-up view of the center of the structure reveals the symmetry around the Zn CRYST with the catalytic domains containing Cu 2+ and Zn 2+ cations, as well as sulfate (SO 4 2- ) and acetate (ACT) anions from the crystal conditions. D) The Zn CRYST brings 4 chains together, gluing them through Chain A and C’s His110 residues, Chain B and D’s His-1 residues which remain as an artefact after thrombin cleavage of the N-terminal hexahistidine tag. The 2Fo-Fc electron density map is contoured at 1σ level and colored in light blue. The distances between the coordinating His residues and Zn CRYST are given in angstroms (Å). View this table: View inline View popup Table 1. Data collection and refinement statistics. The Zn 2+ cation supplemented prior to the crystallization forms a center of symmetry (Zn CRYST ) and glues four different chains in a near-tetragonal geometry with angles of 95.03°, 90.99°, 84.18° and 97.95° ( Figure 2C & D ). During purification, the hexahistidine tag of the recombinant hSOD1 was cleaved using thrombin protease following nickel affinity chromatography. However, residues Ser-2, His-1, and Met0 in chains B and D remain as artefacts, with their electron densities clearly visible at the 1σ level ( Supp. Fig. 1 ). The Zn CRYST anchors these residual His-1 residues in chains B and D, as well as the otherwise flexible His110 residues in chains A and C ( Figure 2D , Supp. Fig. 2 ). The stabilization of metal-coordinated His110 residues by Zn CRYST results in lower individual B-factors and better-defined electron densities compared to the free His110 residues in other chains ( Supp. Figs. 3,4 ). Ellipsoid representations of the B-factors reveal that the acidic core of the crystal structure is more rigid. In contrast, the solvent-exposed peripheral regions display increased flexibility, illustrating a gradient of decreasing rigidity from the core to the periphery ( Figure 2B , Supp. Fig. 5 ). Chain H has the highest average B-factor of all atoms, reaching 96.1 Å 2 and the weakest electron density, making it the most flexible monomer out of twelve in the asymmetric unit. Chains A and B, with B-factors of 53.0 and 55.1 Å 2 , respectively, form the most rigid dimeric pair among those adopting the canonical dimer interface. ( Supp. Fig. 2 ) 2.2. hSOD1 monomers and dimers display modest conformational changes To analyze structural variations among the asymmetric chains, each homodimer and monomer was superposed. The superposition of dimer pairs resulted in Root Mean Square Deviation (RMSD) values ranging from 0.32 Å to 0.68 Å ( Figure 3 ) . Similarly, monomer superposition resulted in RMSD values between 0.28 Å and 0.72 Å, revealing subtle conformational differences among individual chains based on Cα atom alignments ( Figure 4 ) . These observations suggest a modest degree of structural plasticity and heterogeneity. Download figure Open in new tab Figure 3. The superposition of six homodimeric hSOD1 molecules. A, B) Superposition of the hSOD1 dimers shows moderate structural flexibility, with RMSD values ranging from a minimum of 0.32 Å to a maximum of 0.68 Å. C) Pairwise alignment based on Cα atoms reveals notable structural shifts when dimer pair A-B is superimposed onto the remaining five dimeric pairs (C-D, E-F, G-H, I-J, K-L). Specific regions, particularly loop II (residues 23–27) and loop VI (residues 102– 115), exhibit RMSD values up to 2.5 Å, suggesting that these domains are intrinsically flexible. Comparison of the monomers on the left side is referred to as dimerA (A, C, E, G, I, K), while the one on the right is labeled dimerB (B, D, F, H, J, L). The most significant positional shift is observed at the N-terminal Ala1 of dimerB, with a displacement reaching 7 Å (shown up to 4 Å) due to residual and coordinated His-1 residues. Download figure Open in new tab Figure 4. The superposition of twelve monomeric hSOD1 molecules. A, B) Superposition of the hSOD1 monomers shows subtle structural plasticity, with RMSD values ranging from a minimum of 0.28 Å to a maximum of 0.72 Å. C) Pairwise superposition of chain A against the remaining 11 chains (B, C, D, E, F, G, H, I, J, K, L) reveals regions with modest variations. Notably, loop II (residues 23–27), particularly around Asn26, and loop VI (residues 102–115), especially around His110, show RMSD values up to 2.5 Å, indicating inherent flexibility. The first N-terminal residues of chains B and D exhibit the most pronounced shifts compared to other chains, with RMSD values reaching 7 Å (displayed up to 4Å) due to their modified N-terminus containing extra residues. The pairwise alignments were performed to explore the positional differences of equivalent Cα atoms and plotted against the residue numbers ( Figure 3C & 4C ) . The A-B dimeric pair was used as the reference for dimers, while chain A served as the reference for monomers. In the dimeric comparison, monomers on the left side are referred to as dimer A , while those on the right side are denoted as dimer B . Notable structural differences were observed in loop II (residues 23–27) and the Greek key loop, loop VI (residues 102–115), particularly around residues Asn26 and His110. Interestingly, the striking fluctuation of His110, reaching up to 2.4 Å in monomers and 2.3 Å in dimer A , is not observed in dimer B , where the RMSD score is less than 1 Å. The positional shift of His110 is most likely caused by its coordination with Zn CRYST of the reference chain A. As expected,Asn26, His110, and their neighboring residues exhibit consistently high B-factors, distinguishing them from the rest of the structure. The averaged B-factors across the monomers are 100.9 ± 26.8 Å 2 for Gly108, 120.4 ± 24.5 Å 2 for Asp109, 104.6 ± 34.9 Å 2 for His110, and 117.7 ± 18.4 Å 2 for Asn26, all of which significantly exceed the overall average of 69.6 Å 2 . This trend is uniformly observed across all chains, highlighting the intrinsic flexibility of these residues ( Supp. Figs. 2, 3 ). The three artefact residues left after thrombin cleavage of N-terminal hexahistidine tag in chains B and D, positioned near the natural N-terminal Ala1, affect its position. Among them, His-1 plays a primary role in reinforcing this positional shift through its coordination with Zn CRYST , resulting in a deviation of up to 7 Å 2 compared to other chains. The electrostatic loop (residues 122–144), especially around Gly130, Asn131, and Glu132, exhibits a moderate RMSD shift reaching up to 1.4 Å in dimer B . The elevated individual B-factors within loop I (10–13), reaching up to 157.3 Å 2 at residue 11, indicate distinctive disorder in Chain J, resulting in a positional difference of up to 1.6 Å, a variation not observed in any other chain. Although the impact of crystal lattice contacts cannot be excluded, these slight fluctuations may be attributed to the intrinsic plasticity of the hSOD1 enzyme. 2.3. Dynamic water molecules reveal new conformations of the active site Water molecules are primarily steered into the Cu 2+ active site through highly complex mechanistic steps of H bonding and coordination chemistry ( Figure 5 ). Initially, the copper active site predominantly adopts a distorted tetrahedral geometry, where His46 coordinates through its ND1 atom, while His48, His63, and His120 coordinate through their NE2 atoms ( Figure 5A-B ). W1 forms H bonds with other water molecules, first with W2 ( Figure 5C ) and then with W3, W4 and W5 ( Figure 5D ). When W3’s electron cloud is sufficiently close to the His120 residue (∼3.4 Å, Supplementary Figure 6D ), W3 coordinates with this histidine residue ( Figure 5D ). After W3-His120 coordination, W1 coordinates with His63 residue ( Figure 5E ). These coordinations can be further validated by the bond length of Cu 2+ and π-nitrogen atoms of His120 residues gets shortened (1.8 Å) since coordination between τ-nitrogen atoms and W2 molecule increases the electron density on the π-nitrogen atom that can strengthen the coordinated covalent bond (Supplementary Figure 6D-E ). His120 is proposed to be one of the water-steering residues by guiding the H-bonded water molecules into the active site since the coordination length between W1 and His63 residue diminishes while the His63-Cu site length decreases and His120-Cu site length elongates ( Figure 5E ). After the approach of W1 to the copper active site, W3 loses its coordination with the His120 residue. In this mechanistic step, we observed that water molecules can remain in different configurations with various coordinations and bond lengths ( Figure 5F-I ). When W1 is sufficiently close to the His63 residue (2.4 Å, Supplementary Figure 6J ), W1 coordinates with the Cu 2+ to form the water-bound, catalytically native-like form of the SOD1, which causes elongation and significant weakening on the Cu-His63 bond as it is apparent by the evident break on the dissociated electron densities ( Figure 5J ) . After the water-bound form is achieved, strong coordination between the π-nitrogen atom of His63 and Cu 2+ is restored as electron densities re-overlap with each other ( Figure 5K ). Finally, thermodynamically most stable, meshwork water structure forms ( Figure 5L ). Download figure Open in new tab Figure 5. The water coordination of twelve hSOD1 active sites. The center panel displays the superpositions of all 12 active site regions, each centered on the CE1 atom of His63 revealing the positional shifts of water molecules within the active site. Panels A-K illustrate the stepwise choreography of water molecules as they approach and depart from the catalytic site during the enzymatic cycle. The 2 Fo-Fc electron density map, contoured at 1σ and colored in gray, highlights the positions of water molecules and surrounding active site residues. The catalytic Cu 2 ⁺ cation remains consistently coordinated with His63 through a strong covalent bond in all steps, except panel J. W1 ultimately establishes coordination with Cu 2 ⁺, forming the penta-coordinated native state in panels J, K, and L. 2.4. Arg143 dynamics reveal a key allosteric state Our crystallographic data suggests that water molecules mediate allosteric alterations through interactions with the Arg143 residue ( Figure 6 ). The guanidino group of Arg143 forms H bonds with the hydroxyl residue of Thr58 and consistently with the backbone of Cys57 and Gly61, thereby maintaining the integrity of the disulfide loop throughout the structure ( Figure 6A ). As W1 approaches the guanidinium group of Arg143, it coordinates with the ε- and η1-nitrogen atoms of this group ( Figure 6B ). After coordinating with several other water molecules, all ε- and η-nitrogen atoms are surrounded by these coordinated water networks ( Figure 6C-D ). This coordinated water network alters the whole H bond network between the Arg143, Cys57, Thr58, and Gly61, either through bond elongations and shortenings or bond formations and breakings. To exemplify, the H bond between the hydroxyl residue of Thr58 and η2-nitrogen of Arg143 is broken, whilst the H bond between His48 and η1-nitrogen of Arg143 repositions by the formation of H bond among His48 and η2-nitrogen of Arg143 ( Figure 6D ). This reposition’s effect on the structure can be further demonstrated by the simultaneous rearrangement in the Cu active site which causes W3-His120 H bond formation, indicating that this repositioning is the allostericity-driver step ( Figure 5D ). This may play a crucial role in this mechanism as the coordination of the water network with Arg143 likely decreases the electron density on the ε- and η-nitrogen atoms that cause the weakening of H bonds with Cys57, Thr58, and Gly61 residues and cause the bond elongations and breakages. After this step, the water network starts to dissolve, and only the η-nitrogen atoms of Arg143 are coordinated with water molecules ( Figure 6E-F ). When W1 coordinates with W3 and W4 and approaches closer to the η1-nitrogen atom, the H bond between His48 and Arg143 is restored ( Figure 6G ). When this network is rearranged such that coordination within W4, ε- and η1-nitrogen atoms are formed, the electron density of the η1-nitrogen atom and ε-nitrogen atom decreases, causing an accumulation of electron density on the η2-nitrogen atom and restoration of the H bond between Thr58 and Arg143 guanidino group ( Figure 6H-I ). Subsequently, allostericity-driver water molecules start to get further from the arginine residue, and coordination between W1 and Arg143 η1-nitrogen atoms gets broken ( Figure 6J-K ) and recruits new water molecules to form the highly coordinated final state ( Figure 6L ). During this time course, when W1-Arg143 coordination is broken, Cu and W1 coordination is formed in the active site ( Figure 5J ). Due to the highly dense H bond network around Arg143, the H bond between His48 and Arg143 gets broken again ( Figure 6L ). Moreover, as W1, W2, and W3 get further from the allosteric Arg143 site, a coordination network on the active site is formed by these water molecules ( Figure 5L ). Download figure Open in new tab Figure 6. Allosteric water coordination around the Arg143 residue. The center panel displays the superpositions of all twelve Arg143 residues, each centered on the NE atom of Arg143 capturing the dynamic repositioning of water molecules interacting with Arg143 and its partner residues. Panels A-K depict the sequential movement of water molecules as they associate with and dissociate from Arg143 throughout the water steering mechanism. The 2 Fo-Fc electron density map, contoured at 1σ and colored in gray, highlights Arg143, His48, Cys57, Gly61, Thr58, and the surrounding water network. Water molecules labeled with numbers are correspondent with the water molecules indicated on Figure 5 , whilst water molecules labeled as “W” are not interacting with the Arg143 side chain and do not have allosteric importance. 2.5. Docking studies of 9IYK structure Based on the potential of radical scavengers (edaravone, gallic acid and CNN) and Abl1 inhibitors (dasatinib, imatinib and bosutinib) for mitigating the levels of unwanted SOD1 formation, we performed molecular docking assessment for edaravone, gallic acid, CNN, dasatinib, imatinib and bosutinib and their derivatives in the binding pocket of hSOD1 (PDB ID: 9IYK). We retrieved 128 edaravone, 110 gallic acid, 108 CNN, 57 dasatinib, 57 bosutinib and 55 imatinib derivatives using ChEMBL database ( https://www.ebi.ac.uk/chembl/ ). The results showed that many derivatives of edaravone, gallic acid, CNN, dasatinib, bosutinib and imatinib generally showed higher affinity than standard agents. The docking scores of hit edaravone derivatives (CHEMBL4205125, CHEMBL1490540, CHEMBL1390061, CHEMBL1518895, CHEMBL1872892) were found to be −7.641, −7.002, −6.865, −6.767, −6.484 kcal/mol, respectively, compared to edaravone (−4.831kcal/mol). These derivatives interacted with Asn65, Glu49, His63, His80, Ser68, Lys136 ( Figure 7A ). CHEMBL4205125 formed H bonding with Asn65 and π cation and salt bridge formation with Lys136 ( Figure 7B ). Download figure Open in new tab Figure 7. Docking poses (A) and interactions (B) of CHEMBL4205125, CHEMBL1490540, CHEMBL1390061, CHEMBL1518895, CHEMBL1872892 and edaravone in the binding pocket of hSOD1. The histidine residues are labeled according to their three distinct protonation states, which depend on their net charge and the position of their proton(s). HIP carries a +1 charge with both δ- and ε-nitrogens protonated, HID is neutral with only the δ-nitrogen protonated, and HIE is also neutral but with protonation at the ε-nitrogen. [ 58 ] Radical scavengers gallic acid (−5.428 kcal/mol) and CNN (−5.769 kcal/mol) displayed higher affinity than edaravone in the binding pocket of hSOD1. Among gallic acid derivatives, CHEMBL1256379, CHEMBL339835, CHEMBL2146905, CHEMBL47027 and CHEMBL95308 exhibited the most significant interactions with Asn65, His63, His80, Glu49, Lys136, Ser68, Thr135 through H bonding, π cation and salt bridge formation ( Figures 8A and 8B ). Gallic acid also interacted with Zn202 with salt bridge formation. The docking scores were calculated as −7.121, −7.027, −6.794, −6.778 and −6.761 kcal/mol for CHEMBL1256379, CHEMBL339835, CHEMBL2146905, CHEMBL47027 and CHEMBL95308, respectively. Download figure Open in new tab Figure 8. Docking poses (A) and interactions (B) of CHEMBL1256379, CHEMBL339835, CHEMBL2146905, CHEMBL47027 and CHEMBL95308 and gallic acid in the binding site of hSOD1. On the other hand, CNN derivatives showed the highest docking scores compared to edaravone and gallic acid derivatives. CHEMBL1075867, CHEMBL429344, CHEMBL1075871, CHEMBL1075979, CHEMBL1076109 demonstrated the highest affinity with the docking scores of −9.760, −8.935, −8.858, −8.841, −8.757 kcal/mol and interactions with Asn65, His63, His80, Glu49, Glu132, Lys136, Ser68, Thr135 ( Figures 9A and 9B ). Download figure Open in new tab Figure 9. Docking poses (A) and interactions (B) of CHEMBL1075867, CHEMBL429344, CHEMBL1075871, CHEMBL1075979, CHEMBL1076109 and CNN in the binding site of hSOD1. Molecular docking results showed that Abl1 inhibitors (dasatinib, bosutinib and imatinib) generally presented lower affinity compared to radical scavengers (edaravone, gallic acid and CNN) with the docking scores of −5.751, −4.382 and −4.969 kcal/mol, respectively. Among the derivatives of Abl1 inhibitors, the most promising affinity was observed with dasatinib derivatives. The hit dasatinib derivatives, CHEMBL3425716, CHEMBL4451230, CHEMBL4439020, CHEMBL4451230 and CHEMBL5283559, were identified the hit derivatives with the docking scores of −7.244, −7.231, −7.164, −6.972, −6.889 kcal/mol. These derivatives established interactions with Asn65, Arg143, Asp96, Glu100, Glu132, Glu133, Lys70, Lys136, and Trp32 ( Figures 10A and 10B ). Download figure Open in new tab Figure 10. Docking poses (A) and interactions (B) of CHEMBL3425716, CHEMBL4451230, CHEMBL4439020, CHEMBL4451230 and CHEMBL5283559 and dasatinib in the binding site of hSOD1. The docking results of hit bosutinib derivatives, CHEMBL198211, CHEMBL339893, CHEMBL124333, CHEMBL128326 and CHEMBL197930, were scored with −6.459, −6.291, −6.166, −6.156, and −6.142 kcal/mol, respectively. They formed crucial H bonding, π cation, π stacking and salt bridge formation with Asn65, Glu133, His80, Lys70, Lys136 ( Figures 11A and 11B ). Download figure Open in new tab Figure 11. Docking poses (A) and interactions (B) of CHEMBL198211, CHEMBL339893, CHEMBL124333, CHEMBL128326 and CHEMBL197930 and bosutinib in the binding site of hSOD1. The hit imatinib derivatives were identified as CHEMBL4794277, CHEMBL4740754, CHEMBL3098615, CHEMBL4763826 and CHEMBL4797353 with the docking scores of −6.527, −6.491, −6.489, −6.488, and −6.193 kcal/mol. Asn65, Asp96, Glu100, Glu132, Glu133, His80, Lys136, Thr135 were the key residues with which these derivatives interacted ( Figures 12A and 12B ). Download figure Open in new tab Figure 12. Docking poses (A) and interactions (B) of CHEMBL4794277, CHEMBL4740754, CHEMBL3098615, CHEMBL4763826 and CHEMBL4797353 and imatinib in the binding site of hSOD1. 3. Discussion Our 2.3 Å crystal structure of wild-type hSOD1 reveals a previously unreported crystal form, further expanding the diversity of known SOD1 crystallographic arrangements [ 59 ]. Fully metallated, disulfide-containing, and dimeric, eukaryotic SOD1 is exceptionally stable, retaining dismutase activity even in 4 M guanidine-HCl or 8 M urea [ 6 , 60 – 62 ]; yet, it is also remarkably dynamic. Even in our 2.3 Å cryo-crystallographic structure at 100K, hSOD1 visibly demonstrates its flexibility, displaying structural variation across the six dimers and twelve monomers within the same asymmetric unit. This structural framework provides an exceptional opportunity to gain deeper insights into the catalytic site and the dynamic behavior of the surrounding water molecules. The crystal structure presented in our work has a non-cannonical zinc coordination site where Zn CRYST glues residual His-1 residues from chains B and D and His110 residues of chains A and C. His110 has been observed to participate in the coordination of external metal-binding sites in the crystallographic structures of mutant SOD1 but has not been documented to do so in any other wild-type structure. In the monomeric hSOD1 mutant F50E/G51E/E133Q, crystallized in the orthorhombic P212121 space group (PDB ID: 1MFM), His110 directly coordinates one of the nine cadmium cations through its imidazole ring [ 63 ]. In the crystal structure of the double copper-binding site mutant H46R/H48Q, crystallized in the P21 space group (PDB ID: 2NNX), two Zn +2 cations link the dimers through interactions with a water molecule, Glu77, and His110 [ 64 ]. Similarly, in the G85R mutant structures, which affect the metal-binding region and are also crystallized in P21 (PDB IDs: 2VR7, 2VR8), Zn +2 cation is coordinated in a tetrahedral geometry by His110 from one dimer, Glu24 from another dimer, and two thiocyanate anions [ 65 ]. Our wild-type hSOD1 crystal structure, crystallized in a completely different C121 space group, features Zn CRYST bridging two dimers by gluing the His110 residues of chains A and C, along with the residual His-1 from chains B and D. Previous studies have demonstrated that metal-catalyzed oxidation (MCO) modifies local metal-binding sites and preferentially targets histidine residues in SOD1 [ 66 ]. Since His110 is one of the two non-active site modifications, it has been proposed as a transient metal-binding site [ 67 ]. Another study suggests that His110, along with nearby residues Asp109 and Cys111, may contribute to a weak, non-active copper-binding site [ 68 ]. Computational analyses further indicate that His110 is one of eight residues that may influence SOD1’s folding kinetics, potentially leading to its aggregation [ 69 ]. Although two of the four histidines linked to Zn CRYST are non-native, our structure reveals that His110 in wild-type SOD1, not just in pathogenic mutants, can also interact with a metal cation. Our finding strengthens the possibility that His110 may serve as a transient or weak metal-binding site. Superposition of different subunits within our structure reveals slight positional differences in the Cα atoms, particularly at Asn26, His110, Gly130, Asn131, and Glu132; residues that are conserved among eukaryotic SOD1s and located in flexible loop regions [ 13 ]. Among these, Asn26 and Asn131 are also susceptible to deamidation, a post-translational modification that removes the side-chain amide from asparagine or glutamine residues, subtly altering the local protein environment in a way similar to a missense mutation [ 70 , 71 ]. The flexible electrostatic loop (residues 122–144), which contributes to substrate recognition, plays a crucial role in SOD1 function by mediating key interactions within the active site [ 72 ]. Within this region, Glu130 forms H bonds at the N-terminal region of SOD1’s fibrillar structure, while Glu132 is thought to facilitate the electrostatic guidance of the O 2 − anion toward the catalytic site [ 6 , 73 , 74 ]. The flexibility of these residues suggests they may contribute to SOD1’s structural dynamics, enhancing its adaptability and functional regulation, which may explain why none, except for Glu132, have been directly linked to ALS-related pathogenic mutations. Our study illustrates the interplay between water molecules and SOD1’s active site, where conformational dynamics are modulated by water-mediated interactions and H bonding. The stepwise coordination of water molecules within the copper active site orchestrates a dynamic sequence of conformational changes in the catalytic region, guided primarily by the positioning of the bridging His63 and the copper-coordinating His120. Water molecules play a crucial role in reshaping the active site geometry, transitioning it from a distorted tetrahedral to a trigonal bipyramidal configuration. The fluctuation in Cu 2 ⁺-His63 and Cu 2 ⁺-His120 bond lengths during this process reflects a continuous exchange between coordination states as water molecules approach and interact with the metal cation. The coordination dynamics between W1, W3, and the Cu 2 ⁺ ion illustrate how subtle changes in water positioning alter the electronic properties of the active site. The elongation of the Cu-His63 bond (3.0 Å) and the shortening of the Cu-His120 bond (1.8 Å) upon W1 interaction reflect how water coordination rearranges the catalytic environment (Supplementary Figure 6 ). Beyond enabling the formation of the active enzyme state, water molecules further stabilize these transitions through dynamic H bonding interactions. Arg143 in the electrostatic loop selectively interacts with anions via electrostatic forces, positioning it as one of the key regulators of local H bond dynamics [ 7 , 75 ]. The orchestrated dynamics of water molecules influence both allosteric regulation and catalytic activity by interacting with Arg143, leading to conformational changes in the active site. The coordinated water network surrounding its guanidino group triggers a cascade of H bond rearrangements, primarily affecting local and metal-binding regions. These disruptions and reformations reshape the H bond network, ultimately modulating the conformation of the metallocenter. As shown in Figures 5 and 6 , the coordinated water network gradually dissolves after inducing the allosteric changes, followed by the recruitment of new water molecules, which leads to the final configuration of the active site. This cyclical process of water coordination and dissociation suggests a dynamic equilibrium where water molecules continuously modulate the SOD1 enzyme’s conformational states, allowing for flexibility and fine-tuning of its catalytic activity. The restoration of the H bond between Arg143 and Thr58, coupled with the reformation of the Cu 2+ -W1 coordination, represents a crucial step in returning the enzyme to its native-like active conformation. ALS, the third most common neurodegenerative disease after Alzheimer’s and Parkinson’s disorders, leads to degeneration of upper and lower motor neurons in the brain, brainstem and spinal cord, followed by muscle atrophy. ALS, like other diseases of the same spectrum, currently does not have an effective therapy. Although edaravone, riluzole and tofersen are the only drugs approved by the FDA, their beneficial effects on disease progression are limited [ 25 – 27 , 76 ]. There is an urgent need to discover new therapeutics beyond drug repurposing methods to robustly combat ALS. Edaravone, a promising radical scavenger for ALS treatment, encouraged us to investigate the anti-ALS effects of other radical scavengers such as gallic acid and CNN due to their promising effects in neurodegeneration. Among edaravone, gallic acid, CNN and their derivatives, we obtained the best molecular docking results with CNN derivative, CHEMBL1075867. This result indicated that long alkyl chain and benzyl groups contributed significantly to the higher affinity of CHEMBL1075867 compared to that of CNN in the binding site of hSOD1. Abl1 kinase was detected in mutant SOD1 transgenic mice models provoking neuronal damage and apoptosis in ALS motor neurons. Moreover, high levels in the phosphorylation of Abl1 were observed in mutant SOD1 mice. Dasatinib, bosutinib and imatinib, which are potential Abl1 inhibitors, were reported to be effective against misfolded SOD1 protein. Therefore, we performed molecular docking studies for dasatinib, bosutinib, imatinib and their derivatives in the binding pocket of hSOD1. Of these, the most promising results were obtained with dasatinib, while the results of bosutinib and imatinib were found to be similar. Dasatinib derivative CHEMBL3425716 revealed the most significant affinity in the binding site of hSOD1 among the tested derivatives of Abl inhibitors. This outcome indicated that long-chain alkyl esters of CHEMBL3425716 increased the hSOD1 binding potential compared to that of dasatinib. 4. Materials and Methods 4.1. Expression and purification of hSOD1 The human SOD1 (hSOD1) construct was designed with the following amino acid sequence to obtain the N-terminally hexahistidine-tagged recombinant protein: MGSSHHHHHHSSGLVPR(cut)GSHMATKAVCVLKGDGPVQGINFEQKESNGPV KVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLG NVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGS RLAC GVIGIAQ∗ (∗ is stop). The corresponding gene was codon optimized and synthesized by Genscript, USA and cloned into pET28a(+) bacterial expression plasmid by using NdeI and BamHI restriction cleavage sites at 5’ and 3’ ends, respectively. The N-terminal thrombin cut site is colored in red which generated the N-terminus with 3 extra residues shown in blue. The plasmids were transformed into the competent Escherichia coli Rosetta2™ BL21 strain [ 77 ]. The transformed cells were grown in LB supplemented with 50 µg/mL kanamycin and 35 µg/mL chloramphenicol at 30°C, overnight. OD 600 was determined as 0.8 for induction of protein expression by final concentrtion of 0.4 uM IPTG and cells were cultured overnight at 20°C. The cells were centrifuged by using the Beckman Allegra 15R desktop centrifuge at 3500 rpm and 4°C for 30 minutes for harvesting. The bacterial cells were dissolved in the lysis buffer containing 50 mM TRIS-HCl (pH 7.5), 500 mM NaCl, 10 mM imidazole, supplemented with 2 mM 2-mercaptoethanol, 0.1 mM phenylmethylsulfonyl fluoride (PMSF), and 1 mg/ml lysozyme. After, the cells were lysed by sonication with the Branson W250 sonicator (Brookfield, CT, USA). The cell lysate was ultracentrifuged by using The Beckman Optima™ L-80 XP at 35000 rpm for 1 hour at 4°C by using the Ti-45 rotor (Beckman, USA). The pellet containing the insoluble debris was discarded, and the supernatant was loaded into the Ni-NTA agarose column after equilibration, at a 2.5 ml/minute flow rate (Qiagen, Venlo, Netherlands). The equilibration and washing were performed with the buffer, containing 20 mM TRIS-HCl (pH 7.5), 200 mM NaCl, and 20 mM imidazole, while the soluble hSOD1 proteins were eluted in the buffer, containing 20 mM TRIS-HCl (pH 7.5), 200 mM NaCl, and 250 mM imidazole. The eluted protein was placed in the dialysis membrane of 3 kDa cut off and dialyzed against the washing buffer contaning 20 mM TRIS-HCl (pH 7.5), 200 mM NaCl, and 20 mM imidazole overnight at 4°C. In addition, during dialysis the buffer was supplemented with 1:100 thrombin protease to cleave the N-terminal hexa-histidine tag. To collect the hSOD1 without the tag, the protein solution was applied to Ni-NTA column and flowthrough without affinity hexahistidine tag was collected. Then, to get rid of impurities, the collected fractions of the untagged hSOD1 were loaded into the Superdex200 column for size-exclusion chromatography with the buffer containing 20 mM TRIS-HCI pH 7.5, and 150 mM NaCl. The pure hSOD1 supplied with 100 µM CuCl 2 ●2H 2 O and 100 µM ZnCl 2 , was concentrated by ultrafiltration columns from Millipore and stored at −80°C until crystallization trials. 4.2. Crystallization of hSOD1 We employed the sitting-drop micro-batch under the oil screening method for initial crystallization screening, using 72 well Terasaki TM crystallization plates (Greiner-Bio, Germany) as explained by Atalay et al 2023 [ 78 ]. Purified hSOD1 protein at 10 mg/ml was mixed with a 1:1 volumetric ratio with ∼3500 commercially available sparse matrix crystallization screening conditions. The sitting drop solutions were then covered with 16.6 μl of 100% paraffin oil (Tekkim Kimya, Türkiye). All the crystallization experiments were performed at ambient temperature. The crystals were obtained at Crystal Screen™ crystallization screen 1 condition #20 containing 0.1 M Sodium acetate trihydrate (pH 4.6), 0.2 M Ammonium sulfate, 25% w/v Polyethylene glycol 4,000. The protein solution and crystallization condition were further screened with a 4:1 volumetric ratio with 48 different conditions from CryoPro™ screen (Hampton Research, USA) and condition #2 with 6.0 M 1,6-hexanediol yielded the crystals, that were flash-cooled with liquid nitrogen for cryogenic data collection. 4.3. Data collection, processing and structure determination of hSOD1 Diffraction data for the hSOD1 were collected at Diamond Light Source (Didcot, UK), beamline I03 (mx-37045) on a Eiger2 XE 16M detector at 100K using monochromatic radiation at a wavelength of 0.98 Å, oscillation width of 0.10°, beam size of 80×20μm, transmission of 10.00% and exposure time of 0.0072s. In total, 3600 images were collected. The data was automatically processed with Xia2 dials [ 79 , 80 ]. The structure was solved by molecular replacement using PHASER [ 81 ] implemented in PHENIX suite [ 82 ]. 1.06 Å resolution structure of hSOD1 I113T mutant with its ligand (PDB ID: 4A7S) was used as a search model and used for the initial rigid body refinement within the PHENIX software package [ 83 ]. After simulated-annealing refinement, TLS parameters and individual coordinates were refined. We also performed composite omit map refinement implemented in PHENIX to identify potential positions of altered side chains and water molecules, which were checked in the COOT [ 83 ], and positions with strong difference density were retained. The data collection and structure refinement statistics are summarized in Table 1 . 4.4. Molecular Docking To explore potential radical scavengers (edaravone, gallic acid and CNN) and Abl1 inhibitors (dasatinib, imatinib and bosutinib) and their derivatives in the binding site of hSOD1, the ChEMBL database ( https://www.ebi.ac.uk/chembl/ ) was used to obtain the appropriate structures (PDB ID: 9IYK). The crystal structure of the ambient temperature was acquired from the RCSB database ( https://www.rcsb.org/structure/9IYK ). The protein preparation module was used for preparing the crude protein for molecular docking. Prime automatically added missing chains and PropKa calculated the protonation state at physiological pH. SiteMap was then used to identify the highest ranked potential receptor binding sites. The docking grid was determined using grid generation choosing the hit binding site that compromises the specified residues (Asn26, Asn65, Asn131, Arg143, Asp83, Asp96, Cys57, Glu49, Glu100, Glu132, Glu133, Gly61, Gly130, His46, His48, His63, His71, His80, His120, Lys70, Lys136, Ser68, Thr58, Thr135, Trp32, Cu201, and Zn202). Further docking experiments were performed on the generated grid. Meanwhile, compounds were sketched, cleaned and prepared with energy minimization using the OPLS 2005 force field at physiological pH by the LigPrep module. The best minimized structures were then subjected to docking experiments without further modification. The flexible ligand alignment tool was used for the superimposition of our structurally similar ligands. After subjecting the resulting ligand to the Glide/SP docking protocols, the same docking procedures were performed for all tested compounds [ 84 , 85 ](Schrödinger Release 2016-2: Schrödinger, LLC: New York, USA). 5. Conclusions In this study, we determined the high-resolution crystal structure of human SOD1 (hSOD1) at 2.3 Å, capturing an unprecedented view of its active site dynamics, water coordination, and allosteric regulation; while also identifying a non-native external zinc-binding site that bridges multiple chains through His residues. Our findings offer new insights into how water molecules orchestrate key structural transitions, reinforcing their essential role in the enzyme’s catalytic mechanism. By visualizing multiple SOD1 active sites within a single asymmetric unit, we provide a comprehensive picture of water-mediated interactions, particularly in relation to Cu 2 ⁺ and Zn 2 ⁺ coordination. One of the most significant findings of this study is the dynamic choreography of water molecules within the active site. We observed that specific water molecules engage in a stepwise exchange, facilitating proton transfer and maintaining the integrity of the metal coordination network. The flexible nature of these interactions underscores the intrinsic adaptability of hSOD1, allowing it to efficiently regulate the conversion of O 2 − radicals under physiological conditions. Beyond the active site, our data supports the hypothesis that Arg143 is a key allosteric regulator, influencing the electrostatic loop and surrounding H bond network. The structural snapshots captured in our study reveal how water molecules dynamically interact with Arg143, modulating its conformation and likely contributing to enzyme stability and function. Building on our structural analysis, we also explored potential therapeutic avenues by performing molecular docking studies. Among the compounds tested, CHEMBL1075867, a radical scavenger derivative, exhibited the strongest binding to SOD1, outperforming edaravone, the only FDA-approved radical scavenger for ALS. This suggests that structurally optimized scavengers could offer improved neuroprotective effects. Additionally, our docking results highlighted dasatinib derivatives, particularly CHEMBL3425716, as promising candidates for targeting SOD1 misfolding and aggregation. These findings open new directions for drug development efforts aimed at modifying SOD1 behavior in ALS. Overall, our work provides a more detailed view of hSOD1’s structural landscape, shedding further light on how water coordination, metal ion dynamics, and allosteric regulation contribute to its function. By integrating crystallographic data with computational modeling, we bridge the gap between basic structural biology and therapeutic discovery, offering a foundation for future studies aimed at targeting SOD1 in ALS and other neurodegenerative diseases. By expanding our understanding of SOD1’s molecular mechanisms, we hope to contribute to the development of more effective treatment strategies for ALS and related disorders. Supplementary Materials Figure S1: Thrombin-specific N-terminal cleavage of hSOD1; Figure S2: The average B -factors of the monomeric and dimeric forms of hSOD1; Figure S3: Scatter plot of all-atom B -factors for each residue across twelve different chains; Figure S4: The 2Fo-Fc electron density map for the flexible His110 residue; Figure S5: Representation of electrostatic surface potential and ellipsoids of the hSOD1 structure; Figure S6: The water coordination and bond lengths at twelve hSOD1 active sites; Figure S7: Allosteric water coordination and bond lengths around the Arg143 residue. Author Contributions Conceptualization, I.Y., A.G.T., B.S., H.C., A.N.B., and H.D.; methodology, I.Y., A.G.T., B.S., H.C., A.N.B., and H.D.; software, I.Y., A.G.T., B.S., H.C., A.N.B., and H.D. validation, I.Y., A.G.T., B.S., H.C., A.N.B., and H.D.; formal analysis, I.Y., A.G.T., B.S., H.C., A.N.B., and H.D.; investigation, I.Y., A.G.T., B.S., H.C., A.N.B., and H.D.; resources, A.N.B., and H.D.; data curation, I.Y., B.S., H.C., A.N.B., and H.D.; writing—original draft preparation, I.Y., A.G.T., B.S., H.C., A.N.B., and H.D.; writing—review and editing, I.Y., A.G.T., B.S., H.C., A.N.B., and H.D.; visualization, I.Y., B.S., H.C., and H.D.; supervision, A.N.B., and H.D.; project administration, A.N.B., and H.D.; funding acquisition, H.C., A.N.B., and H.D. All authors have read and agreed to the published version of the manuscript. Funding This study was supported by Scientific and Technological Research Council of Turkey (TÜBİTAK) under the Grant Number 122Z429. This publication has also been produced benefiting from the European Union’s Horizon Europe research and innovation programme under the Marie Sktodowska-Curie grant agreement No: 101061939. The authors thank to TÜBİTAK and European Union for their supports. ANB gratefully acknowledges Suna and Inan Kıraç Foundation for its longstanding and visionary support. The use of the services and facilities of the Koç University Research Center for Translational Medicine, KUTTAM, is also gratefully acknowledged. Institutional Review Board Statement Not applicable. Informed Consent Statement Not applicable. Data Availability Statement The atomic coordinates and structure factors have been deposited in the Protein Data Bank (PDB) under accession code 9IYK (Crystal structure of hSOD1 in the C121 space group). Conflicts of Interest The authors declare no conflicts of interest. Acknowledgments The authors would like to thank Diamond Light Source for beamtime (proposal mx-37045), and the staff of beamline I03 for assistance with crystal testing and data collection. We thank the team and tutors of the DLS-CCP4 Data Collection and Structure Solution Workshop 2023 at Diamond Light Source (Oxfordshire, UK); Kay Diederichs, Andrey Lebedev, and Michail Isupov for their discussions and assistance with molecular replacement, and Marco Mazzorana and Felicity Bertram for their help in fishing crystals. Footnotes iyapici21{at}ku.edu.tr (I.Y.); atokur20{at}ku.edu.tr (A.G.T.); hdemirci{at}ku.edu.tr (H.D.); belginsever{at}anadolu.edu.tr (B.S.); hciftci{at}mehmetakif.edu.tr (H.C.); nbasak{at}ku.edu.tr (A.N.B.); hdemirci{at}ku.edu.tr (H.D.) References 1. ↵ Andrés , C. M. C. , J. M. P. d. l. Lastra , C. A. Juan , F. J. Plou and E. Pérez-Lebeña . “ Superoxide anion chemistry—its role at the core of the innate immunity .” International Journal of Molecular Sciences 24 ( 2023 Jan 17) : doi: 10.3390/ijms24031841 . https://pmc.ncbi.nlm.nih.gov/articles/PMC9916283/ . OpenUrl CrossRef PubMed 2. ↵ Fridovich , I . “ Superoxide dismutases .” Annual Review of Biochemistry 44 ( 1975 ) : doi: 10.1146/annurev.bi.44.070175.001051 . https://pubmed.ncbi.nlm.nih.gov/1094908/ . OpenUrl CrossRef 3. ↵ Trist , D. B. G. , D. J. B. Hilton , P. D. J. Hare , P. P. J. Crouch and P. K. L. Double . “ Superoxide dismutase 1 in health and disease: How a frontline antioxidant becomes neurotoxic .” Angewandte Chemie (International Ed. in English) 60 ( 2020 Nov 19) : doi: 10.1002/anie.202000451 . https://pmc.ncbi.nlm.nih.gov/articles/PMC8247289/ . OpenUrl CrossRef 4. ↵ Deng , H.-X. , A. Hentati , J. A. Tainer , Z. Iqbal , A. Cayabyab , W.-Y. Hung , E. D. Getzoff , P. Hu , B. Herzfeldt , R. P. Roos , et al. “ Amyotrophic lateral ssclerosis and structural defects in cu,zn superoxide dismutase .” Science 261 ( 1993 -8-20) : doi: 10.1126/science.8351519 . https://www.science.org/doi/10.1126/science.8351519 . OpenUrl Abstract / FREE Full Text 5. ↵ Hashimoto , S. , K. Ono and H. Takeuchi . “ Uv resonance raman scattering from metal-coordinating histidine residues in cu,zn-superoxide dismutase .” Journal of Raman Spectroscopy 29 ( 1998 /10/01) : doi: 10.1002/(SICI)1097-4555(199810/11)29:10/113.0.CO;2-6 . https://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/%28SICI%291097-4555%28199810/11%2929%3A10/11%3C969%3A%3AAID-JRS328%3E3.0.CO%3B2-6. OpenUrl CrossRef 6. ↵ Rakhit , R. and A. Chakrabartty . “ Structure, folding, and misfolding of cu,zn superoxide dismutase in amyotrophic lateral sclerosis .” Biochimica et Biophysica Acta (BBA) - Molecular Basis of Disease 1762 ( 2006 /11/01) : doi: 10.1016/j.bbadis.2006.05.004 . https://www.sciencedirect.com/science/article/pii/S0925443906000846 . OpenUrl CrossRef PubMed Web of Science 7. ↵ Hart , P. J. , M. M. Balbirnie , N. L. Ogihara , A. M. Nersissian , M. W. Weiss , J. S. Valentine and D. Eisenberg . “ A structure-based mechanism for copper−zinc superoxide dismutase†,‡ .” Biochemistry 38 (02/16/ 1999 ) : doi: 10.1021/bi982284 . https://pubs.acs.org/doi/10.1021/bi982284u . OpenUrl CrossRef 8. ↵ Klug , D. , J. Rabani and I. Fridovich . “ A direct demonstration of the catalytic action of superoxide dismutase through the use of pulse radiolysis .” Journal of Biological Chemistry 247 ( 1972 /08/10) : doi: 10.1016/S0021-9258(19)44987-9 . https://www.sciencedirect.com/science/article/pii/S0021925819449879?via%3Dihub . OpenUrl CrossRef 9. ↵ McCord , J. M. and I. Fridovich . “ The reduction of cytochrome c by milk xanthine oxidase .” Journal of Biological Chemistry 243 ( 1968 /11/10) : doi: 10.1016/S0021-9258(18)91929-0 . https://www.sciencedirect.com/science/article/pii/S0021925818919290?via%3Dihub . OpenUrl CrossRef 10. ↵ Tainer , J. A. , E. D. Getzoff , J. S. Richardson , D. C. Richardson , J. A. Tainer , E. D. Getzoff , J. S. Richardson and D. C. Richardson . “ Structure and mechanism of copper, zinc superoxide dismutase .” Nature 1983 306:5940 306 ( 1983 /11) : doi: 10.1038/306284a0 . https://www.nature.com/articles/306284a0 . OpenUrl CrossRef PubMed Web of Science 11. Hough , M. A. and S. S. Hasnain . “ Crystallographic structures of bovine copper-zinc superoxide dismutase reveal asymmetry in two subunits: Functionally important three and five coordinate copper sites captured in the same crystal .” Journal of Molecular Biology 287 ( 1999 /04/02) : doi: 10.1006/jmbi.1999.2610 . https://www.sciencedirect.com/science/article/pii/S0022283699926104?via%3Dihub . OpenUrl CrossRef PubMed 12. Hough , M. A. and S. S. Hasnain . “ Structure of fully reduced bovine copper zinc superoxide dismutase at 1.15 å .” Structure (London, England : 1993) 11 ( 2003 Aug) : doi: 10.1016/s0969-2126(03)00155-2 . https://www.sciencedirect.com/science/article/pii/S0969212603001552?via%3Dihub . OpenUrl CrossRef 13. ↵ Wright , G. S. A. , S. V. Antonyuk and S. S. Hasnain . “ The biophysics of superoxide dismutase-1 and amyotrophic lateral sclerosis | quarterly reviews of biophysics | cambridge core .” Quarterly Reviews of Biophysics 52 ( 2019 /01) : doi: 10.1017/S003358351900012X . https://www.cambridge.org/core/journals/quarterly-reviews-of-biophysics/article/biophysics-of-superoxide-dismutase1-and-amyotrophic-lateral-sclerosis/163E941CE57056287F750B49E55998A4 . OpenUrl CrossRef 14. ↵ Djinović-Carugo , K. , F. Polticelli , A. Desideri , G. Rotilio , K. S. Wilson and M. Bolognesi . “ Crystallographic study of azide-inhibited bovine cu,zn superoxide dismutase .” Journal of Molecular Biology 240 ( 1994 /07/14) : doi: 10.1006/jmbi.1994.1432 . https://www.sciencedirect.com/science/article/abs/pii/S002228368471432X?via%3Dihub . OpenUrl CrossRef PubMed 15. ↵ Getzoff , E. D. , J. A. Tainer , P. K. Weiner , P. A. Kollman , J. S. Richardson and D. C. Richardson . “ Electrostatic recognition between superoxide and copper, zinc superoxide dismutase .” Nature 306 ( 1983 Nov) : doi: 10.1038/306287a0 . https://www.nature.com/articles/306287a0 . OpenUrl CrossRef PubMed 16. ↵ A., H. M. and H. S. Samar . “ Crystallographic structures of bovine copper-zinc superoxide dismutase reveal asymmetry in two subunits: Functionally important three and five coordinate copper sites captured in the same crystal .” Journal of Molecular Biology 287 ( 1999 /04/02) : doi: 10.1006/jmbi.1999.2610 . https://www.sciencedirect.com/science/article/pii/S0022283699926104?via%3Dihub . OpenUrl CrossRef PubMed 17. ↵ Banci , L. , I. Bertini , M. Borsari , M. S. Viezzoli and R. A. Hallewell . “ Mutation of the metal-bridging proton-donor his63 residue in human cu, zn superoxide dismutase .” European Journal of Biochemistry 232 ( 1995 /08/01) : doi: 10.1111/j.1432-1033.1995.tb20802.x . https://febs.onlinelibrary.wiley.com/doi/10.1111/j.1432-1033.1995.tb20802.x . OpenUrl CrossRef 18. ↵ Shin , D. S. , M. DiDonato , D. P. Barondeau , G. L. Hura , C. Hitomi , J. A. Berglund , E. D. Getzoff , S. C. Cary and J. A. Tainer . “ Superoxide dismutase from the eukaryotic thermophile alvinella pompejana: Structures, stability, mechanism, and insights into amyotrophic lateral sclerosis .” Journal of Molecular Biology 385 ( 2009 /02/06) : doi: 10.1016/j.jmb.2008.11.031 . https://www.sciencedirect.com/science/article/pii/S0022283608014575?via%3Dihub . OpenUrl CrossRef PubMed 19. ↵ Healy , E. F. , R. Flores , V. M. Lynch and S. Toledo . “ Protein dynamics of [cu-zn] superoxide dismutase (sod1): How protein motions at the global and local levels impact the reactivity of sod1 .” Journal of Inorganic Biochemistry 210 ( 2020 /09/01) : doi: 10.1016/j.jinorgbio.2020.111161 . https://www.sciencedirect.com/science/article/pii/S0162013420301896 . OpenUrl CrossRef 20. ↵ Sever , B. , H. Ciftci , H. DeMirci , H. Sever , F. Ocak , B. Yulug , H. Tateishi , T. Tateishi , M. Otsuka , M. Fujita , et al. “ Comprehensive research on past and future therapeutic strategies devoted to treatment of amyotrophic lateral sclerosis .” International Journal of Molecular Sciences 23 ( 2022 /02/22/) : doi: 10.3390/ijms23052400 . https://www.mdpi.com/1422-0067/23/5/2400 . OpenUrl CrossRef 21. ↵ Rosen , D. R. , T. Siddique , D. Patterson , D. A. Figlewicz , P. Sapp , A. Hentati , D. Donaldson , J. Goto , J. P. O’Regan , H.-X. Deng , et al. “ Mutations in cu/zn superoxide dismutase gene are associated with familial amyotrophic lateral sclerosis .” Nature 362 ( 1993 /03/04/) : doi: 10.1038/362059a0 . https://www.nature.com/articles/362059a0 . OpenUrl CrossRef PubMed Web of Science 22. ↵ Abel , O. , J. F. Powell , P. M. Andersen and A. Al-Chalabi . “ Alsod: A user-friendly online bioinformatics tool for amyotrophic lateral sclerosis genetics .” Human Mutation 33 ( 2012 /07/02) : doi: 10.1002/humu.22157 . https://onlinelibrary.wiley.com/doi/10.1002/humu.22157 . OpenUrl CrossRef PubMed 23. ↵ Müller , K. , K.-W. Oh , A. Nordin , S. Panthi , S. H. Kim , F. Nordin , A. Freischmidt , A. C. Ludolph , C. S. Ki , K. Forsberg , et al. “ De novo mutations in sod1 are a cause of als .” Journal of Neurology, Neurosurgery & Psychiatry 93 ( 2022 -02-01) : doi: 10.1136/jnnp-2021-327520 . https://jnnp.bmj.com/content/93/2/201.long . OpenUrl Abstract / FREE Full Text 24. ↵ Grad , L. I. , G. A. Rouleau , J. Ravits and N. R. Cashman . “ Clinical spectrum of amyotrophic lateral sclerosis (als) .” Cold Spring Harbor Perspectives in Medicine 7 ( 2017 Aug) : doi: 10.1101/cshperspect.a024117 . https://pmc.ncbi.nlm.nih.gov/articles/PMC5538408/ . OpenUrl Abstract / FREE Full Text 25. ↵ Jaiswal , M. K. “ Riluzole and edaravone: A tale of two amyotrophic lateral sclerosis drugs .” Medicinal Research Reviews 39 ( 2019 Mar) : doi: 10.1002/med.21528 . https://onlinelibrary.wiley.com/doi/10.1002/med.21528 . OpenUrl CrossRef PubMed 26. Miller , T. M. , M. E. Cudkowicz , A. Genge , P. J. Shaw , G. Sobue , R. C. Bucelli , A. Chiò , P. V. Damme , A. C. Ludolph , J. D. Glass , et al. “ Trial of antisense oligonucleotide tofersen for sod1 als .” New England Journal of Medicine 387 ( 2022 -09-22) : doi: 10.1056/NEJMoa2204705 . https://www.nejm.org/doi/10.1056/NEJMoa2204705?url_ver=Z39.88-2003&rfr_id=ori:rid:crossref.org&rfr_dat=cr_pub%20%200pubmed . OpenUrl CrossRef PubMed 27. ↵ Wiesenfarth , M. , J. Dorst , D. Brenner , Z. Elmas , Ö. Parlak , Z. Uzelac , K. Kandler , K. Mayer , U. Weiland , C. Herrmann , et al. “ Effects of tofersen treatment in patients with sod1-als in a “real-world” setting – a 12-month multicenter cohort study from the german early access program .” eClinicalMedicine 69 ( 2024 /03/01) : doi: 10.1016/j.eclinm.2024.102495 . https://www.sciencedirect.com/science/article/pii/S2589537024000749?via%3Dihub . OpenUrl CrossRef PubMed 28. ↵ Platzer , M. , S. Kiese , T. Tybussek , T. Herfellner , F. Schneider , U. Schweiggert-Weisz and P. Eisner . “ Radical scavenging mechanisms of phenolic compounds: A quantitative structure-property relationship (qspr) study .” Frontiers in Nutrition 9 ( 2022 /04/04) : doi: 10.3389/fnut.2022.882458 . https://www.frontiersin.org/journals/nutrition/articles/10.3389/fnut.2022.882458/full . OpenUrl CrossRef 29. ↵ Bruce , R. M. , J. Santodonato , M. W. Neal and J. S. Robert M. Bruce , Michael W. Neal . “ Summary review of the health effects associated with phenol .” Toxicology and Industrial Health 3 ( 1987 -10-01) : doi: 10.1177/074823378700300407 . https://journals.sagepub.com/doi/10.1177/074823378700300407 . OpenUrl CrossRef PubMed 30. ↵ Watanabe , K. , M. Tanaka , S. Yuki , M. Hirai and Y. Yamamoto . “ How is edaravone effective against acute ischemic stroke and amyotrophic lateral sclerosis? ” Journal of Clinical Biochemistry and Nutrition 62 ( 2018 ) : doi: 10.3164/jcbn.17-62 . https://www.jstage.jst.go.jp/article/jcbn/62/1/62_17-62/_article . OpenUrl CrossRef PubMed 31. ↵ Watanabe , K. , Y. Morinaka , K. Iseki , T. Watanabe , S. Yuki and H. Nishi . “ Structure–activity relationship of 3-methyl-1-phenyl-2-pyrazolin-5-one (edaravone) .” Redox Report 8 ( 2003 -6-1) : doi: 10.1179/135100003225001520 . https://www.tandfonline.com/doi/abs/10.1179/135100003225001520 . OpenUrl CrossRef PubMed Web of Science 32. ↵ Wei , Y. , S. Zhong , H. Yang , X. Wang , B. Lv , Y. Bian , Y. Pei , C. Xu , Q. Zhao , Y. Wu , et al. “ Current therapy in amyotrophic lateral sclerosis (als): A review on past and future therapeutic strategies .” European Journal of Medicinal Chemistry 272 ( 2024 /06/05) : doi: 10.1016/j.ejmech.2024.116496 . https://www.sciencedirect.com/science/article/pii/S0223523424003763?via%3Dihub . OpenUrl CrossRef 33. ↵ Ito , H. , R. Wate , J. Zhang , S. Ohnishi , S. Kaneko , H. Ito , S. Nakano and H. Kusaka . “ Treatment with edaravone, initiated at symptom onset, slows motor decline and decreases sod1 deposition in als mice .” Experimental Neurology 213 ( 2008 /10/01) : doi: 10.1016/j.expneurol.2008.07.017 . https://www.sciencedirect.com/science/article/pii/S001448860800294X?via%3Dihub . OpenUrl CrossRef PubMed 34. ↵ Aoki , M. , H. Warita , H. Mizuno , N. Suzuki , S. Yuki and Y. Itoyama . “ Feasibility study for functional test battery of sod transgenic rat (h46r) and evaluation of edaravone, a free radical scavenger .” Brain Research 1382 ( 2011 /03/25) : doi: 10.1016/j.brainres.2011.01.058 . https://www.sciencedirect.com/science/article/pii/S0006899311001429?via%3Dihub . OpenUrl CrossRef 35. ↵ Badhani , B. , B. Badhani , N. Sharma , N. Sharma , R. Kakkar and R. Kakkar . “ Gallic acid: A versatile antioxidant with promising therapeutic and industrial applications .” RSC Advances 5 ( 2015 /03/16) : doi: 10.1039/C5RA01911G . https://pubs.rsc.org/en/content/articlelanding/2015/ra/c5ra01911g . OpenUrl CrossRef 36. ↵ Ortega-Arellano , H. F. , M. Jimenez-Del-Rio and C. Velez-Pardo . “ Dmp53, basket and drice gene knockdown and polyphenol gallic acid increase life span and locomotor activity in a drosophila parkinson’s disease model .” Genetics and Molecular Biology 36 ( 2013 Nov 8) : doi: 10.1590/S1415-47572013000400020 . https://pmc.ncbi.nlm.nih.gov/articles/PMC3873193/ . OpenUrl CrossRef 37. Parihar , P. , D. Jat , P. Ghafourifar and M. S. Parihar . “ Efficiency of mitochondrially targeted gallic acid in reducing brain mitochondrial oxidative damage .” Cellular and Molecular Biology 60 ( 2014 /07/03) : doi: 10.14715/cmb/23 . https://cellmolbiol.org/index.php/CMB/article/view/532 . OpenUrl CrossRef 38. Seo , E.-J. , N. Fischer and T. Efferth . “ Phytochemicals as inhibitors of nf-κb for treatment of alzheimer’s disease .” Pharmacological Research 129 ( 2018 /03/01) : doi: 10.1016/j.phrs.2017.11.030 . https://www.sciencedirect.com/science/article/pii/S1043661817311349 . OpenUrl CrossRef 39. Rabiei , Z. , K. Solati and H. Amini-Khoei . “ Phytotherapy in treatment of parkinson’s disease: A review .” Pharmaceutical Biology 57 ( 2019 -1-1) : doi: 10.1080/13880209.2019.1618344 . https://www.tandfonline.com/doi/10.1080/13880209.2019.1618344?url_ver=Z39.88-2003&rfr_id=ori:rid:crossref.org&rfr_dat=cr_pub%20%200pubmed . OpenUrl CrossRef 40. ↵ Zahrani , N. A. A. , R. M. El-Shishtawy and A. M. Asiri . “ Recent developments of gallic acid derivatives and their hybrids in medicinal chemistry: A review .” European Journal of Medicinal Chemistry 204 ( 2020 /10/15) : doi: 10.1016/j.ejmech.2020.112609 . https://www.sciencedirect.com/science/article/pii/S022352342030581X?via%3Dihub . OpenUrl CrossRef 41. ↵ Baek , Y. , S.-J. Lee , J. Ryu , S. Jeong , J.-H. Lee and N.-C. Ha . “ Gallic acid inhibits filament formation and promotes the disassembly of superoxide dismutase 1, a protein involved in the pathogenesis of amyotrophic lateral sclerosis .” Food Bioscience 55 ( 2023 /10/01) : doi: 10.1016/j.fbio.2023.102942 . https://www.sciencedirect.com/science/article/pii/S221242922300593X?via%3Dihub . OpenUrl CrossRef 42. ↵ Semchyshyn , H. M . “ Reactive carbonyl species in vivo: Generation and dual biological effects .” The Scientific World Journal 2014 ( 2014 Jan 21) : doi: 10.1155/2014/417842 . https://pmc.ncbi.nlm.nih.gov/articles/PMC3918703/ . OpenUrl CrossRef 43. ↵ Fukuda , A. , T. Osawa , K. Hitomi and K. Uchida . “ 4-hydroxy-2-nonenal cytotoxicity in renal proximal tubular cells: Protein modification and redox alteration .” Archives of Biochemistry and Biophysics 333 ( 1996 /09/15) : doi: 10.1006/abbi.1996.0410 . https://www.sciencedirect.com/science/article/abs/pii/S0003986196904105?via%3Dihub . OpenUrl CrossRef PubMed Web of Science 44. ↵ Herbst , U. , M. Toborek , S. Kaiser , M. P. Mattson and B. Hennig . “ 4-hydroxynonenal induces dysfunction and apoptosis of cultured endothelial cells .” Journal of Cellular Physiology 181 ( 1999 /11/01) : doi: 10.1002/(SICI)1097-4652(199911)181:23.0.CO;2-I . https://onlinelibrary.wiley.com/doi/10.1002/(SICI)1097-4652(199911)181:2%3C295::AID-JCP11%3E3.0.CO;2-I . OpenUrl CrossRef 45. ↵ Dalleau , S. , M. Baradat , F. Guéraud and L. Huc . “ Cell death and diseases related to oxidative stress:4-hydroxynonenal (hne) in the balance .” Cell Death and Differentiation 20 ( 2013 Oct 4) : doi: 10.1038/cdd.2013.138 . https://pmc.ncbi.nlm.nih.gov/articles/PMC3824598/ . OpenUrl CrossRef PubMed 46. ↵ Noguchi , K. , T. F. S. Ali , J. Miyoshi , K. Orito , T. Negoto , T. Biswas , N. Taira , R. Koga , Y. Okamoto , M. Fujita , et al. “ Neuroprotective effects of a novel carnosine-hydrazide derivative on hippocampal ca1 damage after transient cerebral ischemia .” European Journal of Medicinal Chemistry 163 ( 2019 /02/01) : doi: 10.1016/j.ejmech.2018.11.060 . https://www.sciencedirect.com/science/article/pii/S0223523418310195?via%3Dihub . OpenUrl CrossRef PubMed 47. ↵ Martin , L. J . “ Neuronal death in amyotrophic lateral sclerosis is apoptosis: Possible contribution of a programmed cell death mechanism .” Journal of Neuropathology & Experimental Neurology 58 ( 1999 /05/01) : doi: 10.1097/00005072-199905000-00005 . https://academic.oup.com/jnen/article-abstract/58/5/459/2609766?redirectedFrom=fulltext&login=false . OpenUrl CrossRef PubMed 48. S, R. and B. R. “ P53 and cell cycle proteins participate in spinal motor neuron cell death in als - pubmed .” The open pathology journal 4 (01/01/ 2010 ) : doi: 10.2174/1874375701004010011 . https://pubmed.ncbi.nlm.nih.gov/21572928/ . OpenUrl CrossRef 49. ↵ Sathasivam , S. , P. G. Ince and P. J. Shaw . “ Apoptosis in amyotrophic lateral sclerosis: A review of the evidence .” Neuropathology and Applied Neurobiology 27 ( 2001 /08/01) : doi: 10.1046/j.0305-1846.2001.00332.x . https://onlinelibrary.wiley.com/doi/10.1046/j.0305-1846.2001.00332.x . OpenUrl CrossRef PubMed Web of Science 50. ↵ Katsumata , R. , S. Ishigaki , M. Katsuno , K. Kawai , J. Sone , Z. Huang , H. Adachi , F. Tanaka , F. Urano and G. Sobue . “ C-abl inhibition delays motor neuron degeneration in the g93a mouse, an animal model of amyotrophic lateral sclerosis .” PLOS ONE 7 (25 Eyl 2012 ) : doi: 10.1371/journal.pone.0046185 . https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0046185 . OpenUrl CrossRef PubMed 51. ↵ Guo , W. , T. Vandoorne , J. Steyaert , K. A. Staats and L. Van Den Bosch . “ The multifaceted role of kinases in amyotrophic lateral sclerosis: Genetic, pathological and therapeutic implications .” Brain 143 ( 2020 /06/01) : doi: 10.1093/brain/awaa022 . https://academic.oup.com/brain/article/143/6/1651/5811091?login=true . OpenUrl CrossRef 52. Karagiannis , P. and H. Inoue . “ Als, a cellular whodunit on motor neuron degeneration .” Molecular and Cellular Neuroscience 107 ( 2020 /09/01) : doi: 10.1016/j.mcn.2020.103524 . https://www.sciencedirect.com/science/article/pii/S1044743120301470?via%3Dihub . OpenUrl CrossRef 53. Kim , B. W. , Y. E. Jeong , M. Wong , L. J. Martin , B. W. Kim , Y. E. Jeong , M. Wong and L. J. Martin . “ Dna damage accumulates and responses are engaged in human als brain and spinal motor neurons and dna repair is activatable in ipsc-derived motor neurons with sod1 mutations .” Acta Neuropathologica Communications 2020 8:1 8 ( 2020 -01-31) : doi: 10.1186/s40478-019-0874-4 . https://actaneurocomms.biomedcentral.com/articles/10.1186/s40478-019-0874-4 . OpenUrl CrossRef PubMed 54. ↵ Palomo , V. , V. Nozal , E. Rojas-Prats , C. Gil and A. Martinez . “ Protein kinase inhibitors for amyotrophic lateral sclerosis therapy .” British Journal of Pharmacology 178 ( 2020 /08/01) : doi: 10.1111/bph.15221 . https://pubmed.ncbi.nlm.nih.gov/32737989/ . OpenUrl CrossRef 55. ↵ Motaln , H. , B. Rogelj , H. Motaln and B. Rogelj . “ The role of c-abl tyrosine kinase in brain and its pathologies .” Cells 2023, Vol. 12, Page 2041 12 ( 2023 -08-10) : doi: 10.3390/cells12162041 . https://www.mdpi.com/2073-4409/12/16/2041 . OpenUrl CrossRef 56. ↵ Rojas , F. , D. Gonzalez , N. Cortes , E. Ampuero , D. E. Hernández , E. Fritz , S. Abarzua , A. Martinez , A. A. Elorza , A. Alvarez , et al. “ Frontiers | reactive oxygen species trigger motoneuron death in non-cell-autonomous models of als through activation of c-abl signaling .” Frontiers in Cellular Neuroscience 9 ( 2015 /06/09) : doi: 10.3389/fncel.2015.00203 . https://www.frontiersin.org/journals/cellular-neuroscience/articles/10.3389/fncel.2015.00203/full . OpenUrl CrossRef PubMed 57. ↵ Imamura , K. , Y. Izumi , A. Watanabe , K. Tsukita , K. Woltjen , T. Yamamoto , A. Hotta , T. Kondo , S. Kitaoka , A. Ohta , et al. “ The src/c-abl pathway is a potential therapeutic target in amyotrophic lateral sclerosis .” Science Translational Medicine 9 ( 2017 -05-24) : doi: 10.1126/scitranslmed.aaf3962 . https://www.science.org/doi/10.1126/scitranslmed.aaf3962 . OpenUrl FREE Full Text 58. ↵ Kim , M. O. , S. E. Nichols , Y. Wang , J. A. McCammon , M. O. Kim , S. E. Nichols , Y. Wang and J. A. McCammon . “ Effects of histidine protonation and rotameric states on virtual screening of m. Tuberculosis rmlc .” Journal of Computer-Aided Molecular Design 2013 27:3 27 ( 2013 -04-12) : doi: 10.1007/s10822-013-9643-9 . https://link.springer.com/article/10.1007/s10822-013-9643-9 . OpenUrl CrossRef PubMed 59. ↵ Ihara , K. , N. Fujiwara , Y. Yamaguchi , H. Torigoe , S. Wakatsuki , N. Taniguchi and K. Suzuki . “ Structural switching of cu,zn-superoxide dismutases at loop vi: Insights from the crystal structure of 2-mercaptoethanol-modified enzyme .” Bioscience Reports 32 ( 2012 Sep 19) : doi: 10.1042/BSR20120029 . https://pmc.ncbi.nlm.nih.gov/articles/PMC3497728/ . OpenUrl Abstract / FREE Full Text 60. ↵ Forman , H. J. and I. Fridovich . “ On the stability of bovine superoxide dismutase: The effects of metals .” Journal of Biological Chemistry 248 ( 1973 /04/25) : doi: 10.1016/S0021-9258(19)44055-6 . https://www.sciencedirect.com/science/article/pii/S0021925819440556?via%3Dihub . OpenUrl CrossRef 61. Lepock , J. R. , L. D. Arnold , B. H. Torrie , B. Andrews and J. Kruuv . “ Structural analyses of various cu2+, zn2+-superoxide dismutases by differential scanning calorimetry and raman spectroscopy .” Archives of Biochemistry and Biophysics 241 ( 1985 /08/15) : doi: 10.1016/0003-9861(85)90380-7 . https://www.sciencedirect.com/science/article/abs/pii/0003986185903807?via%3Dihub . OpenUrl CrossRef PubMed Web of Science 62. ↵ Arnesano , F. , L. Banci , I. Bertini , M. Martinelli , Y. Furukawa and T. V. O’Halloran . “ The unusually stable quaternary structure of human cu,zn-superoxide dismutase 1 is controlled by both metal occupancy and disulfide status .” Journal of Biological Chemistry 279 ( 2004 /11/12) : doi: 10.1074/jbc.M406021200 . https://www.sciencedirect.com/science/article/pii/S0021925820679388?via%3Dihub . OpenUrl Abstract / FREE Full Text 63. ↵ Ferraroni , M. , W. Rypniewski , K. S. Wilson , M. S. Viezzoli , L. Banci , I. Bertini and S. Mangani . “ The crystal structure of the monomeric human sod mutant f50e/g51e/e133q at atomic resolution. The enzyme mechanism revisited .” Journal of Molecular Biology 288 ( 1999 /05/07) : doi: 10.1006/jmbi.1999.2681 . https://www.sciencedirect.com/science/article/pii/S0022283699926815 . OpenUrl CrossRef PubMed Web of Science 64. ↵ Wang , J. , A. Caruano-Yzermans , A. Rodriguez , J. P. Scheurmann , H. H. Slunt , X. Cao , J. Gitlin , P. J. Hart and D. R. Borchelt . “ Disease-associated mutations at copper ligand histidine residues of superoxide dismutase 1 diminish the binding of copper and compromise dimer stability .” Journal of Biological Chemistry 282 ( 2007 /01/05) : doi: 10.1074/jbc.M604503200 . https://www.sciencedirect.com/science/article/pii/S0021925820798236?via%3Dihub . OpenUrl Abstract / FREE Full Text 65. ↵ Cao , X. , S. V. Antonyuk , S. V. Seetharaman , L. J. Whitson , A. B. Taylor , S. P. Holloway , R. W. Strange , P. A. Doucette , J. S. Valentine , A. Tiwari , et al. “ Structures of the g85r variant of sod1 in familial amyotrophic lateral sclerosis .” Journal of Biological Chemistry 283 ( 2008 /06/06) : doi: 10.1074/jbc.M801522200 . https://www.sciencedirect.com/science/article/pii/S002192582046154X?via%3Dihub . OpenUrl Abstract / FREE Full Text 66. ↵ Rakhit , R. , P. Cunningham , A. Furtos-Matei , S. Dahan , X.-F. Qi , J. P. Crow , N. R. Cashman , L. H. Kondejewski and A. Chakrabartty . “ Oxidation-induced misfolding and aggregation of superoxide dismutase and its implications for amyotrophic lateral sclerosis .” Journal of Biological Chemistry 277 ( 2002 /12/06) : doi: 10.1074/jbc.M207356200 . https://www.sciencedirect.com/science/article/pii/S0021925819714914?via%3Dihub . OpenUrl Abstract / FREE Full Text 67. ↵ Rakhit , R. , J. P. Crow , J. R. Lepock , L. H. Kondejewski , N. R. Cashman and A. Chakrabartty . “ Monomeric cu,zn-superoxide dismutase is a common misfolding intermediate in the oxidation models of sporadic and familial amyotrophic lateral sclerosis .” Journal of Biological Chemistry 279 ( 2004 /04/09) : doi: 10.1074/jbc.M313295200 . https://www.sciencedirect.com/science/article/pii/S0021925819639530?via%3Dihub . OpenUrl Abstract / FREE Full Text 68. ↵ Hongbin Liu , Haining Zhu , Daryl K. Eggers , Aram M. Nersissian , Kym F. Faull , Joy J. Goto , ‖, Jingyuan Ai , Joann Sanders-Loehr , a. Edith Butler Gralla and Joan Selverstone Valentine* . “ Copper(2+) binding to the surface residue cysteine 111 of his46arg human copper−zinc superoxide dismutase, a familial amyotrophic lateral sclerosis mutant† .” (June 20, 2000 ) : doi: 10.1021/bi000846 . https://pubs.acs.org/doi/10.1021/bi000846f . OpenUrl CrossRef 69. ↵ Sharma , S. , F. Ding and N. V. Dokholyan . “ Probing protein aggregation using simplified models and discrete molecular dynamics .” Frontiers in bioscience : a journal and virtual library 13 ( 2008 May 1) : doi: 10.2741/3039 . https://pmc.ncbi.nlm.nih.gov/articles/PMC2497428/ . OpenUrl CrossRef 70. ↵ Shi , Y. , N. R. Rhodes , A. Abdolvahabi , T. Kohn , N. P. Cook , A. A. Marti and B. F. Shaw . “ Deamidation of asparagine to aspartate destabilizes cu, zn superoxide dismutase, accelerates fibrillization, and mirrors als-linked mutations .” (October 10, 2013 ) : doi: 10.1021/ja407801 . https://pubs.acs.org/doi/10.1021/ja407801x . OpenUrl CrossRef 71. ↵ Trist , B. G. , S. Genoud , S. Roudeau , A. Rookyard , A. Abdeen , V. Cottam , D. J. Hare , M. White , J. Altvater , J. A. Fifita , et al. “ Altered sod1 maturation and post-translational modification in amyotrophic lateral sclerosis spinal cord .” Brain 145 ( 2022 May 5) : doi: 10.1093/brain/awac165 . https://pmc.ncbi.nlm.nih.gov/articles/PMC9473357/ . OpenUrl CrossRef PubMed 72. ↵ Xia , Y. , Z. Chen , G. Xu , D. R. Borchelt , J. I. Ayers and B. I. Giasson . “ Novel sod1 monoclonal antibodies against the electrostatic loop preferentially detect misfolded sod1 aggregates .” Neuroscience Letters 742 ( 2021 /01/18) : doi: 10.1016/j.neulet.2020.135553 . https://www.sciencedirect.com/science/article/pii/S0304394020308235?via%3Dihub . OpenUrl CrossRef 73. ↵ Getzoff , E. D. , D. E. Cabelli , C. L. Fisher , H. E. Parge , M. S. Viezzoli , L. Banci and R. A. Hallewell . “ Faster superoxide dismutase mutants designed by enhancing electrostatic guidance .” Nature 1992 358:6384 358 ( 1992 /07) : doi: 10.1038/358347a0 . https://www.nature.com/articles/358347a0 . OpenUrl CrossRef PubMed Web of Science 74. ↵ Wang , L.-Q. , Y. Ma , H.-Y. Yuan , K. Zhao , M.-Y. Zhang , Q. Wang , X. Huang , W.-C. Xu , B. Dai , J. Chen , et al. “ Cryo-em structure of an amyloid fibril formed by full-length human sod1 reveals its conformational conversion .” Nature Communications 2022 13:1 13 ( 2022 -06-17) : doi: 10.1038/s41467-022-31240-4 . https://www.nature.com/articles/s41467-022-31240-4 . OpenUrl CrossRef 75. ↵ Fisher , C. , D. Cabelli , R. Hallewell , P. Beroza , T. P. Lo , E. Getzoff and J. Tainer . “ Computational, pulse-radiolytic, and structural investigations of lysine-136 and its role in the electrostatic triad of human c u,z n superoxide dismutase .” Proteins: Structure, Function, and Bioinformatics ( 1994 ) : doi: 10.1002/(SICI)1097-0134(199709)29:13.0.CO;2-G . https://www.semanticscholar.org/paper/Computational%2C-pulse%E2%80%90radiolytic%2C-and-structural-of-Fisher-Cabelli/165a41f336e5e371e7a0d1bf5131de3c48899890 . OpenUrl CrossRef 76. ↵ Abe , K. , M. Aoki , S. Tsuji , Y. Itoyama , G. Sobue , M. Togo , C. Hamada , M. Tanaka , M. Akimoto , K. Nakamura , et al. “ Safety and efficacy of edaravone in well defined patients with amyotrophic lateral sclerosis: A randomised, double-blind, placebo-controlled trial .” The Lancet Neurology 16 ( 2017 /07/01) : doi: 10.1016/S1474-4422(17)30115-1 . https://www.thelancet.com/journals/laneur/article/PIIS1474-4422(17)30115-1/abstract . OpenUrl CrossRef PubMed 77. ↵ Ertem , F. B. , O. Guven , C. Buyukdag , O. Gocenler , E. Ayan , B. Yuksel , M. Gul , G. Usta , B. Cakılkaya , J. A. Johnson , et al. “ Protocol for structure determination of sars-cov-2 main protease at near-physiological-temperature by serial femtosecond crystallography .” STAR Protocols 3 ( 2022 /03/18) : doi: 10.1016/j.xpro.2022.101158 . https://www.sciencedirect.com/science/article/pii/S2666166722000387 . OpenUrl CrossRef PubMed 78. ↵ Atalay , N. , E. K. Akcan , M. Gül , E. Ayan , E. Destan , F. B. E. Kuzucu , N. Tokay , B. Çakilkaya , Z. Nergiz , G. K. Usta , et al. “Cryogenic x-ray crystallographic studies of biomacromolecules at turkish light source “ turkish delight ”.“ Turkish Journal of Biology 47 ( 2023 ) : doi: 10.55730/1300-0152.2637 . https://journals.tubitak.gov.tr/biology/vol47/iss1/2/ . OpenUrl CrossRef 79. ↵ Winter , G. and G. Winter . “ Xia2: An expert system for macromolecular crystallography data reduction .” urn:issn:0021-8898 43 ( 2009 -12-01) : doi: 10.1107/S0021889809045701 . https://onlinelibrary.wiley.com/iucr/doi/10.1107/S0021889809045701 . OpenUrl CrossRef PubMed Web of Science 80. ↵ Winter , G. , D. G. Waterman , J. M. Parkhurst , A. S. Brewster , R. J. Gildea , M. Gerstel , L. Fuentes-Montero , M. Vollmar , T. Michels-Clark , I. D. Young , et al. “ Dials: Implementation and evaluation of a new integration package .” Acta Crystallographica. Section D, Structural Biology 74 ( 2018 Feb 1) : doi: 10.1107/S2059798317017235 . https://pmc.ncbi.nlm.nih.gov/articles/PMC5947772/ . OpenUrl CrossRef PubMed 81. ↵ McCoy , A. J. , R. W. Grosse-Kunstleve , P. D. Adams , M. D. Winn , L. C. Storoni and R. J. Read . “ Phaser crystallographic software .” Journal of Applied Crystallography 40 ( 2007 Jul 13) : doi: 10.1107/S0021889807021206 . https://pmc.ncbi.nlm.nih.gov/articles/PMC2483472/ . OpenUrl CrossRef PubMed Web of Science 82. ↵ Adams , P. D. , P. V. Afonine , G. Bunkóczi , V. B. Chen , I. W. Davis , N. Echols , J. J. Headd , L.-W. Hung , G. J. Kapral , R. W. Grosse-Kunstleve , et al. “ Phenix: A comprehensive python-based system for macromolecular structure solution .” urn:issn:0907-4449 66 ( 2010 -01-22) : doi: 10.1107/S0907444909052925 . https://journals.iucr.org/d/issues/2010/02/00/dz5186/index.html . OpenUrl CrossRef PubMed Web of Science 83. ↵ Wright , G. S. A. , S. V. Antonyuk , N. M. Kershaw , R. W. Strange , S. Samar Hasnain , G. S. A. Wright , S. V. Antonyuk , N. M. Kershaw , R. W. Strange and S. Samar Hasnain . “ Ligand binding and aggregation of pathogenic sod1 .” Nature Communications 2013 4:1 4 ( 2013 -04-23) : doi: 10.1038/ncomms2750 . https://www.nature.com/articles/ncomms2750 . OpenUrl CrossRef PubMed 84. ↵ Ciftci , H. , B. Sever , E. Ayan , M. Can , H. DeMirci , M. Otsuka , A. F. TuYuN , H. Tateishi and M. Fujita . “ Identification of new l-heptanoylphosphatidyl inositol pentakisphosphate derivatives targeting the interaction with hiv-1 gag by molecular modelling studies .” Pharmaceuticals 15 ( 2022 Oct 12) : doi: 10.3390/ph15101255 . https://pmc.ncbi.nlm.nih.gov/articles/PMC9610595/ . OpenUrl CrossRef PubMed 85. ↵ Guven , O. , B. Sever , F. Başoğlu-Ünal , A. Ece , H. Tateishi , R. Koga , M. O. Radwan , N. Demir , M. Can , M. D. Aytemir , et al. “ Structural characterization of traf6 n-terminal for therapeutic uses and computational studies on new derivatives .” Pharmaceuticals 2023, Vol. 16, Page 1608 16 ( 2023 -11-14) : doi: 10.3390/ph16111608 . https://www.mdpi.com/1424-8247/16/11/1608 . OpenUrl CrossRef PubMed View the discussion thread. Back to top Previous Next Posted February 21, 2025. Download PDF Supplementary Material Email Thank you for your interest in spreading the word about bioRxiv. NOTE: Your email address is requested solely to identify you as the sender of this article. Your Email * Your Name * Send To * Enter multiple addresses on separate lines or separate them with commas. You are going to email the following Structural Insights into the Dynamics of Water in SOD1 Catalysis and Drug Interactions Message Subject (Your Name) has forwarded a page to you from bioRxiv Message Body (Your Name) thought you would like to see this page from the bioRxiv website. Your Personal Message CAPTCHA This question is for testing whether or not you are a human visitor and to prevent automated spam submissions. Share Structural Insights into the Dynamics of Water in SOD1 Catalysis and Drug Interactions Ilkin Yapici , Arda Gorkem Tokur , Belgin Sever , Halilibrahim Ciftci , Ayse Nazli Basak , Hasan DeMirci bioRxiv 2025.02.18.638811; doi: https://doi.org/10.1101/2025.02.18.638811 Share This Article: Copy Citation Tools Structural Insights into the Dynamics of Water in SOD1 Catalysis and Drug Interactions Ilkin Yapici , Arda Gorkem Tokur , Belgin Sever , Halilibrahim Ciftci , Ayse Nazli Basak , Hasan DeMirci bioRxiv 2025.02.18.638811; doi: https://doi.org/10.1101/2025.02.18.638811 Citation Manager Formats BibTeX Bookends EasyBib EndNote (tagged) EndNote 8 (xml) Medlars Mendeley Papers RefWorks Tagged Ref Manager RIS Zotero Tweet Widget Facebook Like Google Plus One Subject Area Molecular Biology Subject Areas All Articles Animal Behavior and Cognition (7635) Biochemistry (17691) Bioengineering (13892) Bioinformatics (41937) Biophysics (21452) Cancer Biology (18589) Cell Biology (25504) Clinical Trials (138) Developmental Biology (13378) Ecology (19899) Epidemiology (2067) Evolutionary Biology (24320) Genetics (15609) Genomics (22506) Immunology (17736) Microbiology (40394) Molecular Biology (17181) Neuroscience (88605) Paleontology (666) Pathology (2832) Pharmacology and Toxicology (4824) Physiology (7641) Plant Biology (15156) Scientific Communication and Education (2045) Synthetic Biology (4294) Systems Biology (9825) Zoology (2271)

Text is read by the "Ask this paper" AI Q&A widget below. Extraction quality varies by source — PMC NXML preserves structure cleanly, OA-HTML may include some navigation residue, and OA-PDF can have broken hyphenation. The publisher copy (via DOI) is the canonical version.

My notes (saved in your browser only)

Ask this paper AI returns verbatim quotes from the full text · source: preprint-html

Answers must be backed by verbatim quotes from this paper's full text. Hallucinated quotes are dropped automatically; if no verbatim passage answers the question, we say so. How this works

Citation neighborhood (no data yet)

We don't have any in-corpus citations linked to this paper yet. This is a recent paper (2025) — citers typically take a year or two to land, and the OpenAlex reference graph may still be filling in.

Source provenance

europepmc
last seen: 2026-05-20T01:45:00.602351+00:00