Ion transport peptide regulates body water balance via a receptor guanylyl cyclase in the Drosophila hindgut

preprint OA: closed
📄 Open PDF Full text JSON View at publisher

Abstract

Maintaining internal water balance, including ionic and osmotic balance, is critical for animal development and survival. In insects, internal water balance is regulated through the Malpighian tubules and the hindgut, which transport water and ions across their epithelia under the regulation of multiple peptide hormones. One of these, ion transport peptide (ITP), a member of the highly conserved crustacean hyperglycemic hormone superfamily among ecdysozoans, is an anti-diuretic hormone in insects, but its mechanism of action remains largely unclear. Here, we show that the short amidated isoform of ITP (saITP), secreted from brain neurosecretory cells, regulates water absorption via the receptor guanylyl cyclase (rGC) Gyc76C in the hindgut of the fruit fly Drosophila melanogaster . Both ITP and Gyc76C are evolutionarily conserved and are essential for larval survival in D. melanogaster , as mutation or knockdown of either gene results in early larval lethality. In Drosophila S2 cells, synthetic saITP increases intracellular cyclic GMP (cGMP) in a Gyc76C-dependent manner, an effect abolished by deletion of its putative ligand-binding domain. Using the fluorescent cGMP biosensor RedcGull in ex vivo -cultured hindguts, we found that saITP increases epithelial cGMP levels, and this response requires Gyc76C. Consistently, saITP promotes hindgut water reabsorption via Gyc76C. Thus, saITP acts via Gyc76C in a brain-hindgut neuroendocrine axis that regulates internal water balance during development. Our study provides new insight into the neuroendocrine control of osmoregulation in ecdysozoans and supports a broader role for rGCs in peptide-hormone signaling.
Full text 88,411 characters · extracted from preprint-html · click to expand
Ion transport peptide regulates body water balance via a receptor guanylyl cyclase in the Drosophila hindgut | bioRxiv /* */ /* */ <!-- <!-- /*! * yepnope1.5.4 * (c) WTFPL, GPLv2 */ (function(a,b,c){function d(a){return"[object Function]"==o.call(a)}function e(a){return"string"==typeof a}function f(){}function g(a){return!a||"loaded"==a||"complete"==a||"uninitialized"==a}function h(){var a=p.shift();q=1,a?a.t?m(function(){("c"==a.t?B.injectCss:B.injectJs)(a.s,0,a.a,a.x,a.e,1)},0):(a(),h()):q=0}function i(a,c,d,e,f,i,j){function k(b){if(!o&&g(l.readyState)&&(u.r=o=1,!q&&h(),l.onload=l.onreadystatechange=null,b)){"img"!=a&&m(function(){t.removeChild(l)},50);for(var d in y[c])y[c].hasOwnProperty(d)&&y[c][d].onload()}}var j=j||B.errorTimeout,l=b.createElement(a),o=0,r=0,u={t:d,s:c,e:f,a:i,x:j};1===y[c]&&(r=1,y[c]=[]),"object"==a?l.data=c:(l.src=c,l.type=a),l.width=l.height="0",l.onerror=l.onload=l.onreadystatechange=function(){k.call(this,r)},p.splice(e,0,u),"img"!=a&&(r||2===y[c]?(t.insertBefore(l,s?null:n),m(k,j)):y[c].push(l))}function j(a,b,c,d,f){return q=0,b=b||"j",e(a)?i("c"==b?v:u,a,b,this.i++,c,d,f):(p.splice(this.i++,0,a),1==p.length&&h()),this}function k(){var a=B;return a.loader={load:j,i:0},a}var l=b.documentElement,m=a.setTimeout,n=b.getElementsByTagName("script")[0],o={}.toString,p=[],q=0,r="MozAppearance"in l.style,s=r&&!!b.createRange().compareNode,t=s?l:n.parentNode,l=a.opera&&"[object Opera]"==o.call(a.opera),l=!!b.attachEvent&&!l,u=r?"object":l?"script":"img",v=l?"script":u,w=Array.isArray||function(a){return"[object Array]"==o.call(a)},x=[],y={},z={timeout:function(a,b){return b.length&&(a.timeout=b[0]),a}},A,B;B=function(a){function b(a){var a=a.split("!"),b=x.length,c=a.pop(),d=a.length,c={url:c,origUrl:c,prefixes:a},e,f,g;for(f=0;f<d;f++)g=a[f].split("="),(e=z[g.shift()])&&(c=e(c,g));for(f=0;f<b;f++)c=x[f](c);return c}function g(a,e,f,g,h){var i=b(a),j=i.autoCallback;i.url.split(".").pop().split("?").shift(),i.bypass||(e&&(e=d(e)?e:e[a]||e[g]||e[a.split("/").pop().split("?")[0]]),i.instead?i.instead(a,e,f,g,h):(y[i.url]?i.noexec=!0:y[i.url]=1,f.load(i.url,i.forceCSS||!i.forceJS&&"css"==i.url.split(".").pop().split("?").shift()?"c":c,i.noexec,i.attrs,i.timeout),(d(e)||d(j))&&f.load(function(){k(),e&&e(i.origUrl,h,g),j&&j(i.origUrl,h,g),y[i.url]=2})))}function h(a,b){function c(a,c){if(a){if(e(a))c||(j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}),g(a,j,b,0,h);else if(Object(a)===a)for(n in m=function(){var b=0,c;for(c in a)a.hasOwnProperty(c)&&b++;return b}(),a)a.hasOwnProperty(n)&&(!c&&!--m&&(d(j)?j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}:j[n]=function(a){return function(){var b=[].slice.call(arguments);a&&a.apply(this,b),l()}}(k[n])),g(a[n],j,b,n,h))}else!c&&l()}var h=!!a.test,i=a.load||a.both,j=a.callback||f,k=j,l=a.complete||f,m,n;c(h?a.yep:a.nope,!!i),i&&c(i)}var i,j,l=this.yepnope.loader;if(e(a))g(a,0,l,0);else if(w(a))for(i=0;i (function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0];var j=d.createElement(s);var dl=l!='dataLayer'?'&l='+l:'';j.src='//www.googletagmanager.com/gtm.js?id='+i+dl;j.type='text/javascript';j.async=true;f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-M677548'); Skip to main content Home About Submit ALERTS / RSS Search for this keyword Advanced Search New Results Ion transport peptide regulates body water balance via a receptor guanylyl cyclase in the Drosophila hindgut View ORCID Profile Akira Watanabe , View ORCID Profile Takashi Koyama , View ORCID Profile Olga Kubrak , View ORCID Profile Michael James Texada , Megumi Furumitsu , Eiko Iwakoshi-Ukena , View ORCID Profile Roilea Maxson , View ORCID Profile Taishi Yoshii , View ORCID Profile Shu Kondo , View ORCID Profile Naoki Yamanaka , View ORCID Profile Kazuyoshi Ukena , View ORCID Profile Kim Rewitz , View ORCID Profile Ryusuke Niwa , View ORCID Profile Naoki Okamoto doi: https://doi.org/10.1101/2025.10.24.684309 Akira Watanabe 1 Degree Programs in Life and Earth Sciences, Graduate School of Science and Technology, University of Tsukuba , Tennodai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Akira Watanabe Takashi Koyama 2 Department of Biology, Section for Cell and Neurobiology, University of Copenhagen , Universitetsparken 15, Building 3, 2100 Copenhagen, Denmark Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Takashi Koyama Olga Kubrak 2 Department of Biology, Section for Cell and Neurobiology, University of Copenhagen , Universitetsparken 15, Building 3, 2100 Copenhagen, Denmark Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Olga Kubrak Michael James Texada 2 Department of Biology, Section for Cell and Neurobiology, University of Copenhagen , Universitetsparken 15, Building 3, 2100 Copenhagen, Denmark Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Michael James Texada Megumi Furumitsu 3 Graduate School of Integrated Sciences for Life, Hiroshima University , Hiroshima 739-8521, Japan Find this author on Google Scholar Find this author on PubMed Search for this author on this site Eiko Iwakoshi-Ukena 3 Graduate School of Integrated Sciences for Life, Hiroshima University , Hiroshima 739-8521, Japan Find this author on Google Scholar Find this author on PubMed Search for this author on this site Roilea Maxson 4 Department of Entomology, Institute for Integrative Genome Biology, University of California , Riverside, 900 University Ave , Riverside, CA 92521, USA Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Roilea Maxson Taishi Yoshii 5 Graduate School of Environmental, Life, Natural Science and Technology, Okayama University , Okayama, 700-8530, Japan Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Taishi Yoshii Shu Kondo 6 Department of Biological Science and Technology, Faculty of Advanced Engineering, Tokyo University of Science , 6-3-1 Niijuku, Katsushika-ku, Tokyo 125-8585, Japan Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Shu Kondo Naoki Yamanaka 4 Department of Entomology, Institute for Integrative Genome Biology, University of California , Riverside, 900 University Ave , Riverside, CA 92521, USA Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Naoki Yamanaka Kazuyoshi Ukena 3 Graduate School of Integrated Sciences for Life, Hiroshima University , Hiroshima 739-8521, Japan Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Kazuyoshi Ukena Kim Rewitz 2 Department of Biology, Section for Cell and Neurobiology, University of Copenhagen , Universitetsparken 15, Building 3, 2100 Copenhagen, Denmark Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Kim Rewitz Ryusuke Niwa 7 Life Science Center for Survival Dynamics, Tsukuba Advanced Research Alliance (TARA), University of Tsukuba , Tennodai 1-1-1, Tsukuba, Ibaraki 305-8577, Japan Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Ryusuke Niwa Naoki Okamoto 7 Life Science Center for Survival Dynamics, Tsukuba Advanced Research Alliance (TARA), University of Tsukuba , Tennodai 1-1-1, Tsukuba, Ibaraki 305-8577, Japan Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Naoki Okamoto For correspondence: naoki-okamoto{at}tara.tsukuba.ac.jp Abstract Full Text Info/History Metrics Supplementary material Preview PDF Abstract Maintaining internal water balance, including ionic and osmotic balance, is critical for animal development and survival. In insects, internal water balance is regulated through the Malpighian tubules and the hindgut, which transport water and ions across their epithelia under the regulation of multiple peptide hormones. One of these, ion transport peptide (ITP), a member of the highly conserved crustacean hyperglycemic hormone superfamily among ecdysozoans, is an anti-diuretic hormone in insects, but its mechanism of action remains largely unclear. Here, we show that the short amidated isoform of ITP (saITP), secreted from brain neurosecretory cells, regulates water absorption via the receptor guanylyl cyclase (rGC) Gyc76C in the hindgut of the fruit fly Drosophila melanogaster . Both ITP and Gyc76C are evolutionarily conserved and are essential for larval survival in D. melanogaster , as mutation or knockdown of either gene results in early larval lethality. In Drosophila S2 cells, synthetic saITP increases intracellular cyclic GMP (cGMP) in a Gyc76C-dependent manner, an effect abolished by deletion of its putative ligand-binding domain. Using the fluorescent cGMP biosensor RedcGull in ex vivo -cultured hindguts, we found that saITP increases epithelial cGMP levels, and this response requires Gyc76C. Consistently, saITP promotes hindgut water reabsorption via Gyc76C. Thus, saITP acts via Gyc76C in a brain-hindgut neuroendocrine axis that regulates internal water balance during development. Our study provides new insight into the neuroendocrine control of osmoregulation in ecdysozoans and supports a broader role for rGCs in peptide-hormone signaling. Introduction Maintaining water homeostasis, including the regulation of ionic and osmotic balance, is essential for the development and survival of all animals ( 1 ). Although the underlying mechanisms vary depending on their habitat, many animals, including insects, rely on endocrine systems to coordinate systemic water and ion balance ( 2 , 3 ). In insects, water and ion balance is primarily maintained by the Malpighian tubules and the hindgut, organs functionally analogous to the vertebrate kidney and large intestine. These organs, like their mammalian counterparts, dynamically adjust water and ion reabsorption or excretion in response to multiple neuropeptides and peptide hormones ( 3 – 5 ). Ion transport peptide (ITP), a member of the crustacean hyperglycemic hormone (CHH) superfamily, is important for water homeostasis and is widely conserved among ecdysozoans ( 6 , 7 ). ITP was initially identified in the desert locust Schistocerca gregaria as a hormone promoting ion and fluid transport across the hindgut epithelium ( 8 – 10 ). Subsequent studies established ITP as an anti-diuretic hormone in the fruit fly Drosophila melanogaster , particularly under conditions of dehydration or desiccation stress ( 11 ). In addition to its role in water homeostasis, ITP exhibits significant pleiotropy in insects, regulating metabolism, molting, circadian rhythm, and reproduction ( 12 – 20 ). This functional diversity may arise from the alternative splicing of the ITP gene, which leads to the translation of multiple isoforms. At least two evolutionarily conserved isoforms are produced from the ITP gene: a short, C-terminally amidated isoform (hereafter referred to as short amidated ITP or saITP) and a longer, non-amidated isoform (ITP-like or ITPL) ( 6 ). In S. gregaria , only saITP was found to promote water transport in the hindgut ( 21 ). Similar findings were recently reported in the yellow fever mosquito Aedes aegypti , in which knockdown of saITP but not ITPL transcripts resulted in abnormal water homeostasis ( 19 ). Although these results lend further support to a conserved role for saITP in ion and fluid transport across insect species, the molecular mechanisms that underlie the differential actions of the saITP and ITPL isoforms remain unclear, especially the relevant receptor(s) mediating their actions. Some studies have suggested that CHH superfamily members act via receptor guanylyl cyclases (rGCs), because cyclic GMP (cGMP) is the predominant second messenger in osmoregulation ( 22 , 23 ), whereas other studies have suggested G protein-coupled receptors (GPCRs) as the transducers of CHH-family peptide activity ( 24 ). In the silkmoth Bombyx mori , three GPCRs reportedly respond to saITP and ITPL in cell culture ( 25 , 26 ). More recently, another group found that Drosophila ITPL2 exerts an anti-diuretic effect in the Malpighian tubules via the tachykinin-related peptide (TRP) receptor TkR99D ( 17 ). The phylogenetic distribution of these GPCRs do not fully match the evolutionary conservation of the CHH superfamily. Moreover, the TRP receptor exhibits a higher affinity for its canonical ligand, TRP, than for ITPL ( 26 ). This suggests the existence of one or more as-yet-unidentified, bona fide ITP receptors. In this study, we used the D. melanogaster model to identify an evolutionarily conserved receptor for saITP, the ITP isoforms previously implicated in regulating water homeostasis ( 19 , 21 ). We demonstrate that saITP, secreted from neurosecretory cells (NSCs) in the brain, regulates water homeostasis through the rGC Gyc76C in the hindgut of D. melanogaster . Both ITP and Gyc76C are essential for larval survival and are evolutionarily conserved among ecdysozoans. In Drosophila S2 cells and ex vivo cultured hindguts, we found that application of synthetic saITP induced a robust increase in intracellular cGMP through Gyc76C and that this increase required its putative ligand-binding domain (LBD). We also found that hindgut-specific Gyc76C knockdown eliminated the water reabsorption effect of saITP. Thus, our results indicate that saITP acts via Gyc76C in a neuroendocrine circuit operating through a brain–hindgut axis to maintain water balance during development. Results saITP is a neuroendocrine peptide specifically produced in the brain In many insects, saITP is produced primarily by NSCs in the brain, whereas ITPL is additionally expressed in diverse peripheral tissues ( 6 , 12 , 15 , 18 , 19 , 25 , 27 ). In D. melanogaster , the ITP gene encodes, through alternative splicing, a single saITP and two ITPLs, ITPL1 and ITPL2 ( 27 ). In a tissue-specific larval expression analysis, we found that ITPL1 and ITPL2 are broadly expressed in peripheral tissues (Fig. S1A), whereas saITP expression is restricted to the larval central nervous system (CNS) during development ( Fig. 1A and S1A). To characterize the saITP -expressing cells of the CNS, we generated a saITP::T2A::GAL4 driver line that mimics endogenous saITP expression. Consistent with previous reports ( 27 ), we found evidence of saITP expression in several NSC populations, including four pairs of ITP-immunoreactive protocerebral ( ipc-1 ) neurons in the larval brain, a single pair of ITP-immunoreactive subesophageal ( isog ) neurons in the subesophageal zone, and a few pairs of ITP-immunoreactive abdominal ganglion ( iag ) neurons in the ventral nerve cord ( Fig. 1B ). Notably, the axons of the ipc-1 neurons project to the neurohemal organ called the corpora cardiaca (CC), which may be a site of saITP secretion into the hemolymph. Indeed, we confirmed via immunostaining with an anti-saITP antibody that saITP is strongly localized within the CC-targeting projections of the ipc-1 neurons ( Fig. 1C ). These results suggest that, during larval life, saITP is predominantly produced by NSCs in the CNS and released into circulation at sites near the CC. This is consistent with findings in S. gregaria , in which hindgut ion-transport activity is stimulated specifically by extracts from the brain and CC ( 8 – 10 ). Download figure Open in new tab Figure 1: saITP produced by the CNS is essential for survival during development. A-C , saITP is specifically produced by brain NSCs. A , Relative expression levels of saITP in various tissues, as assessed by RT-qPCR. WB, whole body; CNS, central nervous system; SG, salivary glands; FB, fat body; Tra, tracheae; MT, Malpighian tubules; ID, imaginal discs; Car, carcass. Values are normalized to expression in WB. B and C , saITP::T2A::GAL4 expression (green) ( B ) and saITP immunoreactivity (yellow) ( C ) in the dissected CNS of wandering third instar larvae. Nuclei were stained with DAPI (magenta). saITP::T2A::GAL4 was visualized by UAS-mCD8::GFP ( B ). The right image in each panel shows a magnified view of the area outlined by the dotted square. The arrowheads indicate the ipc-1 neurons, and the arrow indicates projections to the CC. Scale bars, 100 µm. D and E , Survival rate 24 hrs of hatching (AH) ( D ) and larval mortality rates ( E ) of control ( ITP SK2-4 / + ), ITP mutant ( ITP SK2-4 /ITP Df ), and saITP isoform-specific mutant ( ITP SK2-4 /saITP AW1 ) larvae. F , Mortality rates of larvae with tissue-specific ITP knockdown using the following GAL4 driver lines: TubP (ubiquitous), nSyb (pan-neuronal), and R12G03 ( ipc-1 neurons). Each GAL4 line was crossed to UAS-ITP RNAi . Larvae were reared at 25 individuals per vial, and the data represent the results of three independent experiments ( D , E , and F ). Data are presented as means ± SD. Sample sizes ( n ) are indicated on each graph. ** p < 0.01, *** p < 0.001, **** p < 0.0001, as assessed by one-way ANOVA with Dunnett’s test for multiple comparisons to the control ( D , E , and F ). Brain-derived saITP is essential during development Given the critical role of water homeostasis in animal development and viability, we hypothesized that ITP loss-of-function during Drosophila development would likely induce lethality. Indeed, both a CRISPR-generated mutant lacking all ITP isoforms ( ITP SK2-4 ) and ubiquitous ITP knockdown caused lethality during the first larval instar within 24 hrs of hatching ( Fig. 1D ), with no larvae able to progress to the pupal stage ( Fig. 1E and F ). This is consistent with a previous report that ubiquitous knockdown of ITP causes developmental lethality ( 16 ). Furthermore, both pan-neuronal ( nSyb-GAL4 ) and ipc-1 neuron-specific ( R12G03-GAL4 ) knockdown of ITP led to larval lethality ( Fig. 1E and S1B). To determine whether this phenotype was caused by loss of saITP , rather than the other variants, we used CRISPR/Cas9 to generate a saITP isoform-specific mutant. As with the ITP null mutant, the resulting saITP mutant ( saITP AW1 ) exhibited strong lethality during the first larval instar ( Fig. 1D and E ). Together, these results suggest that brain-derived saITP is essential for survival during larval development. Identification of evolutionarily conserved candidate receptors for saITP Previous studies in B. mori identified two GPCRs, Bombyx orphan neuropeptide GPCR (BNGR)-A2 and BNGR-A34, as candidate saITP receptors ( 25 ). BNGR-A2 is conserved only within certain Lepidopteran species, whereas BNGR-A34 orthologs are present in a number of dipteran and coleopteran genomes, including that of D. melanogaster ( 25 ). The phylogenetic distribution of these GPCRs, however, does not match the broad evolutionary conservation of the CHH superfamily across arthropods ( 25 ). In addition, BNGR-A24 and TkR99D, which are potential receptors for ITPL in B. mori and D. melanogaster , respectively ( 17 , 25 ), encode TRP receptors ( 26 , 28 ) with higher affinity for TRP ligands than for ITPL ( 26 ). To determine whether these GPCRs are bona fide saITP receptors in D. melanogaster , we analyzed the developmental phenotypes of mutants lacking CG30340 (the Drosophila ortholog of BNGR-A34 ) and TkR99D . If either of these GPCRs is an saITP receptor, loss of its function should phenocopy the loss of saITP and drive larval lethality. Both CG30340 attP and TkR99D attP mutants, however, were viable and without any evidence of larval lethality (Fig. S2A). Recognition of peptide hormones by their cognate receptors often relies on specific structural motifs dictated by conserved amino acids ( 29 – 31 ). As a member of the CHH superfamily, saITP contains six conserved cysteine residues that likely contribute to forming a specific three-dimensional conformation via disulfide bridges ( Fig. 2A ) ( 6 , 32 , 33 ). To identify candidate receptors that recognize this structural motif, we used the ScanProsite tool ( https://prosite.expasy.org/scanprosite/ ) to search for neuropeptides and peptide hormones in the Drosophila genome with a cysteine pattern similar to that of saITP. This survey revealed a partial match between saITP and eclosion hormone (EH), another peptide hormone that contains six conserved cysteines ( Fig. 2A ). Notably, both peptides share an identical arrangement of four internal cysteine residues (C-X 2 -C-X 12 -C-X 3 -C) ( Fig. 2A ), suggesting a similar tertiary structure and possibly recognition by the same class of receptors. Since EH acts via an rGC in S. gregaria , D. melanogaster , and the oriental fruit fly Bactrocera dorsalis , ( 34 – 36 ), we hypothesized that saITP may also signal via an rGC. Download figure Open in new tab Figure 2: Phylogenetic analysis and in vivo RNAi screening to identify candidate saITP receptors. A , Multiple alignment of the amino-acid sequences of mature saITP/CHH peptides in holometabolous insects ( D. melanogaster ; yellow fever mosquito, Aedes aegypti ; silk moth, Bombyx mori ; red flour beetle, Tribolium castaneum ; western honey bee, Apis mellifera ), a hemimetabolous insect (human body louse, Pediculus humanus ), and a crustacean (water flea, Daphnia pulex ), and EH from D. melanogaster . Peptides encoded by all ITP orthologs contain six highly conserved cysteine residues that form three disulfide bonds. The shaded regions in the amino-acid sequences indicate the identical arrangement of four internal cysteine residues (C-X 2 -C-X 12 -C-X 3 -C) in saITP/CHH and EH. B and C , Phylogenetic analysis of rGC proteins in the genomes of arthropods and vertebrates. B , Neighbor-joining tree constructed using the full amino-acid sequences of rGC proteins from vertebrates (human, Homo sapiens ; mouse, Mus musculus ; zebrafish, Danio rerio ) and arthropods ( D. melanogaster , A. aegypti , B. mori , T. castaneum , A. mellifera , P. humanus , and D. pulex ). Protein names and GenBank accession numbers are listed in Table S1. The scale bar represents an evolutionary distance of 0.1 amino-acid substitutions per site. C , Presence or absence of ITP/CHH, EH, and rGCs in selected arthropods and vertebrate species. Orthologs in the indicated species were identified by BLAST analysis of their genome assemblies and are indicated by “+” (presence) or “−” (absence). D , Larval mortality rates following ubiquitous knockdown of genes encoding rGCs. Larvae were reared at 25 individuals per vial, and the data represent the results of three independent experiments. TubP-GAL4>UAS-Dicer-2 was used as a ubiquitously expressing driver. Data are presented as means ± SD. Sample sizes ( n ) are shown in each graph. * p < 0.05, ** p < 0.01, **** p 0.05). The Drosophila genome encodes seven rGCs: CG3216, CG10738 (hereafter referred to as EH receptor or EHR ), CG31183 , CG33958 , CG34357 , Gyc32E , and Gyc76C . EHR functions as a receptor for EH ( 35 ), but the other receptors’ cognate ligands remain unknown. To assess the evolutionary conservation of these receptors, we examined the orthologs of these seven rGC-encoding genes across a broad range of arthropods and vertebrates. Four of the rGC-encoding genes— CG31183 , EHR , Gyc32E , and Gyc76C —are highly conserved across all examined arthropod species ( Fig. 2C ). Notably, orthologs of three rGCs, such as EHR , Gyc32E , and Gyc76C , are absent in vertebrates but are uniformly present within Arthropoda, paralleling the phylogenetic distribution of the CHH superfamily ( Fig. 2C ). To assess the potential for each of the seven Drosophila rGCs to function as a receptor for saITP, we ubiquitously knocked down all rGCs in the larval stage and analyzed lethality as a readout. Knockdown of EHR or Gyc76C resulted in near-total larval lethality ( Fig. 2D ), an outcome that was confirmed using an alternative RNAi line for each gene (Fig. S2B). Given that EH and EHR are required for molting during larval development in D. melanogaster ( 35 , 37 , 38 ), EHR knockdown-induced lethality is consistent with its known function. Thus, Gyc76C emerged as the top saITP-receptor candidate. Synthetic saITP elevates intracellular cGMP levels via Gyc76C To determine whether saITP activates Gyc76C, we conducted in vitro assays in which chemically synthesized Drosophila saITP was applied to Drosophila S2 cells. This saITP contained the three disulfide bonds and C-terminal amidation that characterize active CHH-superfamily peptides ( 39 , 40 ). Since members of the CHH superfamily, including saITP, signal via the second messenger cGMP ( 7 , 41 ), we assessed receptor activation by measuring intracellular cGMP levels. Addition of saITP to untransformed S2 cells did not induce a cGMP response ( Fig. 3A ). Overexpression of Gyc76C in S2 cells led to elevated basal cGMP levels, and the addition of synthetic saITP further increased cGMP levels significantly ( Fig. 3A ), indicating that exogenous Gyc76C is sufficient for saITP responses in these cells. In contrast, S2 cells overexpressing EHR did not respond to saITP ( Fig. 3A ). When we added an alternative reported ligand of Gyc76C, the VQQ peptide of Neuropeptide-like precursor 1 (Nplp1-VQQ) ( 42 ), we did not observe any increase in cGMP levels (Fig. S3A). This lack of second-messenger response suggests that Nplp1-VQQ does not activate Gyc76C under our assay conditions. Download figure Open in new tab Figure 3: Gyc76C function in the hindgut is essential for survival during development. A, Intracellular cGMP levels in S2 cells expressing Gyc76C , EHR , and Gyc76C-ΔLBD , with (+) or without (−) the addition of synthetic saITP. pActin-GAL4 was used to express each rGC in S2 cells. Values are shown relative to the control (−). B and C , Survival rate 24 hrs AH ( B ) and larval mortalities ( C ) for controls ( Gyc76C 1 / + ) and Gyc76C mutants ( Gyc76C 1 / Gyc76C Df ). D , Relative expression levels of Gyc76C in different tissues, as assessed by RT-qPCR. E , Gyc76C::T2A::GAL4 expression patterns in different tissues of wandering third instar larvae. Nuclei were stained with DAPI (magenta). Gyc76C::T2A::GAL4 was crossed to UAS-mCD8::GFP . Strong reporter expression was apparent in the hindgut, but only low levels were observed in the proventriculus (PV), gastric caeca (GC), and midgut. Reporter was also expressed in the Malpighian tubules (MT), expect for their initial segments (IS), and in the fat body. Scale bars, 500 µm (gut and MT) and 100 µm (fat body). F , Larval mortality rates following tissue-specific knockdown of Gyc76C driven by the following GAL4 driver lines: TubP-GAL4 (ubiquitous), nSyb-GAL4 (pan-neuronal), Cg-GAL4 (fat body), NP1093-GAL4 (principal cells of the Malpighian tubules), Uro-GAL4 (principal cells of the Malpighian tubules in the main segments), tsh(c724)-GAL4 (stellate cells of the Malpighian tubules), Myo1A-GAL4 (gut enterocytes), and byn-GAL4 (hindgut). Each GAL4 line was crossed to UAS-Gyc76C RNAi . Larvae were reared at 25 individuals per vial, and the data represent the results of three independent experiments ( B , C and F ). Data are presented as means ± SD. Sample sizes ( n ) are shown in each graph. *** p < 0.001, **** p < 0.0001, as assessed by one-way ANOVA with Tukey’s test for multiple comparisons ( A ), unpaired t tests (two-tailed) ( B and C ), or one-way ANOVA with Dunnett’s test for multiple comparisons to the control ( F ). ns: not significant ( p > 0.05). To confirm whether the cGMP response to saITP observed in Gyc76C -expressing cells requires direct binding to Gyc76C, we generated a deletion construct lacking the predicted extracellular ligand binding domain (LBD) of Gyc76C ( Gyc76C-ΔLBD ). S2 cells expressing this construct Gyc76C-ΔLBD showed neither the basal cGMP elevation nor the saITP-induced cGMP response that we observed in controls ( Fig. 3A ), indicating that the LBD is required for Gyc76C-mediated saITP response and suggesting that saITP exerts its effect via a direct interaction with the Gyc76C LBD. The increase in basal cGMP levels in S2 cells overexpressing Gyc76C even before saITP addition suggests that S2 cells may secrete endogenous ligands that activate Gyc76C in an autocrine or paracrine manner. To test this, we knocked down endogenous ITP in Gyc76C -expressing cells and observed a significant reduction in basal cGMP concentration (Fig. S3B), suggesting that S2 cells produce and secrete ITP peptides capable of activating Gyc76C in S2 cells. Indeed, the FlyAtlas expression database ( http://flyatlas.org/atlas.cgi ) reports S2-cell expression of ITP . To further evaluate whether Gyc76C alone is sufficient for saITP signal transduction, we performed ligand-stimulation assays using human HEK293T cells overexpressing Drosophila Gyc76C . In these cells, however, saITP application did not induce a significant increase in cGMP levels (Fig. S3C). This lack of effect suggests that saITP signaling via Gyc76C requires additional co-factors or cell-type-specific machinery that is present in S2 cells but absent in HEK293T cells. Gyc76C function in the hindgut is essential for survival during development Since we found that ubiquitous knockdown of Gyc76C phenocopied the lethality of saITP mutants ( Fig. 2D and S2B), we next generated a Gyc76C loss-of-function mutant using CRISPR/Cas9. Consistent with our RNAi results, we found that Gyc76C mutant ( Gyc76C 1 / Df ) did not survive beyond 24 hrs post-hatching ( Fig. 3B ), with no larvae progressing to puparium formation ( Fig. 3C ). This developmental phenotype closely resembles that of saITP mutants. To identify where this lethality phenotype might arise, we performed a tissue-specific analysis of Gyc76C expression. We found broad expression of Gyc76C in the CNS and peripheral tissues ( Fig. 3D ). Using a Gyc76C::T2A::GAL4 knock-in line, which mimics endogenous Gyc76C expression, we observed reporter expression in multiple tissues, including the gut, Malpighian tubules, and fat body ( Fig. 3E ). Within the gut, Gyc76C showed particularly high expression in the hindgut ( Fig. 3E ), which is a known target tissue of saITP in the desert locust ( 33 ). We next assessed the developmental viability of strains carrying GAL4 transgenes driving targeted in lines with tissue-specific Gyc76C knockdown of Gyc76C in relevant tissues. Strikingly, we found that hindgut-specific knockdown of Gyc76C induced significant larval lethality ( Fig. 3F ). In contrast, Gyc76C knockdown in other osmoregulatory tissues, including the principal cells ( NP1093-GAL4 and Uro-GAL4 ) and stellate cells ( tsh[c724]-GAL4 ) of the Malpighian tubules, had no effect on developmental viability ( Fig. 3F ). These findings demonstrate that Gyc76C in the hindgut is essential for survival during development and suggest that the hindgut as the primary target of saITP in D. melanogaster . saITP acts directly in the hindgut epithelium through Gyc76C To directly determine whether saITP acts on the hindgut, we performed ex vivo live imaging of dissected hindguts after saITP addition. To visualize changes in intracellular cGMP levels, we established a UAS transgenic line to permit tissue-specific expression of the red fluorescent cGMP sensor RedcGull ( 43 ). When we added synthetic saITP to third instar larval hindguts expressing RedcGull , we observed a robust increase in cGMP signal in hindgut epithelial cells ( Fig. 4A ). Download figure Open in new tab Figure 4: saITP acts directly on the hindgut epithelium to promote water reabsorption via Gyc76C. A and B, saITP acts directly on the hindgut to increase intracellular cGMP levels via Gyc76C. A , RedcGull fluorescence intensity in the hindgut of larvae with (+) or without (−) addition of synthetic saITP. B , RedcGull fluorescence intensity in the hindgut of control and Gyc76C RNAi ( Gyc76C -i) larvae treated with saITP. Left graphs show temporal changes in RedcGull fluorescence intensity. Right graphs show quantification of RedcGull fluorescence intensity at 120 seconds post-stimulation. The average fluorescence intensity immediately before the addition of the reagent was defined as F 0 and used to normalize the values at all other time points. byn-GAL4 ( A ) and byn-GAL4 TS ( B ) were used as hindgut-specific drivers. C and D , water reabsorption rates ( C ) and contraction rates ( D ) in the hindgut of control and Gyc76C -i larvae with (+) or without (−) addition of synthetic saITP. E , Schematic structure of the engineered membrane-tethered saITP protein. From the N terminus, the construct comprised mTagBFP2, a transmembrane domain, and saITP connected via a linker sequence, producing a membrane-anchored version of saITP that acts on its receptor in a constitutive autocrine (or potentially juxtacrine) manner. F , Total body water content in control and Gyc76C-i wandering third instar larvae with (+) or without (−) expression of tethered-saITP ( T-saITP ). G , Hemolymph osmolality (mOsm/kg) in control and Gyc76C-i third instar larvae. In all Gyc76C knockdown experiments, larvae were reared at 18 °C during the early larval stages (L1 and L2) and shifted to 29 °C from 0 hr after third instar ecdysis to induce RNAi from the third instar. Data are presented as means ± SD. Sample sizes ( n ) are shown in each graph. ** p < 0.01, *** p < 0.001, **** p 0.05). Notably, this response was strongly attenuated by simultaneous hindgut-specific knockdown of Gyc76C ( Fig. 4B ). These results demonstrate that saITP acts directly on the hindgut to increase intracellular cGMP levels in a Gyc76C-dependent manner. To determine whether other Gyc76C -expressing tissues also respond to saITP, we next expressed RedcGull in the fat body, which expresses high levels of Gyc76C ( Fig. 3D and E ). We then monitored cGMP levels after saITP treatment. In contrast to the strong response induced in the hindgut, saITP application to the fat body did not induce changes in cGMP levels (Fig. S4). Combined with the lack of observable saITP response in mammalian HEK293T cells expressing Gyc76C (Fig. S3C), these results suggest that Gyc76C alone is insufficient for saITP signaling. Instead, saITP appears to require tissue-specific co-receptors or cofactors present in the hindgut but not in the fat body. saITP promotes water reabsorption in the hindgut via Gyc76C In insects, the hindgut is a key organ in the regulation of internal water balance as it performs the essential function of reabsorbing water and ions from excreta ( 3 ). Given the lethal phenotypes we observed with loss-of-function of either saITP or Gyc76C , we hypothesized that saITP-Gyc76C signaling promotes water reabsorption in the hindgut. To test this, we used an ex vivo water-reabsorption assay to quantify the rate of water uptake from the hindgut lumen ( 44 , 45 ). We found that synthetic saITP significantly increased water reabsorption via the larval hindgut ( Fig. 4C ), paralleling the induction of cGMP signaling ( Fig. 4B ). Furthermore, this effect was abolished by hindgut-specific knockdown of Gyc76C ( Fig. 4C ). These effects strongly suggest that saITP acts in the hindgut via Gyc76C to promote water reabsorption. Notably, saITP had no effect on hindgut peristalsis ( Fig. 4D ), suggesting that saITP-mediated regulation of water reabsorption is independent of gut motility. To further investigate whether saITP-Gyc76C signaling in the hindgut contributes to systemic water balance, we measured the total water content of third instar larvae. Since Gyc76C is expressed across multiple tissues, and endogenous saITP is a secreted factor that presumably can reach these locations, we could not use saITP overexpression to analyze any tissue-specific saITP actions. To overcome this, we engineered a membrane-tethered form of saITP ( UAS-tethered-saITP or T-saITP ). The membrane-tethered saITP would be anticipated to activate its receptor in a constitutive autocrine (or potentially juxtacrine) manner ( Fig. 4E ), without directly perturbing signaling in non-targeted tissues. Knockdown of Gyc76C in the hindgut reduced larval water content compared to control animals ( Fig. 4F ), consistent with the results of the reabsorption experiment ( Fig. 4C ), suggesting that endogenous saITP-mediated Gyc76C signaling in the larval hindgut contributes to basal water homeostasis. On the other hand, targeted expression of T-saITP in the hindgut significantly increased larval water content, an effect consistent with enhanced water reabsorption in the hindgut epithelium ( Fig. 4F ). When we combined T-saITP expression with hindgut-specific knockdown of Gyc76C , the resulting larvae showed water content similar to that of animals expressing hindgut-specific Gyc76C knockdown alone ( Fig. 4F ), confirming that saITP regulates systemic water balance through hindgut Gyc76C. To further investigate whether Gyc76C in the hindgut contributes to systemic water balance, we measured larval hemolymph osmolality. Hindgut-specific Gyc76C knockdown increased osmolality relative to controls ( Fig. 4G ), consistent with reduced hindgut water reabsorption and therefore increased systemic dehydration. Interestingly, we also found that hindgut-specific expression of T-saITP severely impaired larval growth, resulting in smaller pupae (Fig. S5). Although the mechanisms by which perturbation of systemic water balance might reduce body size remain unclear, hindgut-specific knockdown of Gyc76C completely suppressed this phenotype (Fig. S5), further supporting the notion that saITP acts on the hindgut through Gyc76C. Together, these findings demonstrate that saITP acts through Gyc76C to promote water reabsorption in the hindgut, thereby contributing to the maintenance of systemic water balance. Discussion Terrestrial animals, including insects, must maintain proper internal water balance for both development and survival ( 3 – 5 ). In insects, water and ion homeostasis are primarily regulated by the Malpighian tubules and the hindgut, which dynamically adjust the reabsorption and excretion of water and ions in response to multiple neuropeptides and peptide hormones ( 3 – 5 ). However, our current understanding of water and ion homeostasis in insects, including D. melanogaster , has largely been derived from endocrine studies focusing on the Malpighian tubules ( 3 – 5 ). In contrast, the molecular mechanisms underlying water balance regulation in the hindgut remain poorly understood. In this study, we identified the saITP as a key neuroendocrine factor that acts on the hindgut to regulate systemic water balance in D. melanogaster . saITP is expressed in NSCs in the brain, and its expression is essential for larval survival. Furthermore, we demonstrated that saITP promotes cGMP production in the hindgut epithelium through activation of an rGC Gyc76C, thereby inducing water reabsorption. saITP was originally discovered as a bioactive peptide extracted and purified from the brain and CC of locusts that promotes hindgut water reabsorption ( 7 ). Our findings provide clear genetic evidence that, as it does in locusts, Drosophila saITP functions as a neuroendocrine factor acting on the larval hindgut to regulate systemic water balance. Our study reveals a critical brain–hindgut axis required for larval survival and provides new insights into the neuroendocrine control of water homeostasis during insect development. Through phylogenetic and functional analyses, we identified Gyc76C as a candidate receptor for saITP in D. melanogaster . Another recent study independently implicated Gyc76C in saITP signaling in adult D. melanogaster by showing that saITP inhibition of LK-and DH31-stimulated Malpighian tubule fluid secretion depends on Gyc76C ( 46 ), supporting our findings. Using tissue-specific knockdown, we demonstrated that Gyc76C is essential in the hindgut for survival during development, but dispensable in other larval osmoregulatory tissues, such as the Malpighian tubules. Furthermore, using ex vivo live cGMP imaging and water-reabsorption assays, we demonstrated that saITP promotes water uptake in the hindgut epithelium via Gyc76C. Notably, we used a membrane-tethered saITP with spatially restricted activity to confirm its direct role in modulating water balance via Gyc76C in the hindgut epithelium. We also showed that the predicted extracellular LBD of Gyc76C is essential for saITP-dependent cGMP activation in cultured S2 cells, strongly suggesting that Gyc76C binds saITP directly as its ligand. Although EH acts on a different rGC, EHR ( 34 – 36 ), it shares with saITP an identical arrangement of four cysteine residues (C-X 2 -C-X 12 -C-X 3 -C). This structural motif may be a key determinant of ligand recognition by rGCs. In vertebrates, natriuretic peptides (NPs) and guanylins—endogenous rGC ligands—also require disulfide bonds between cysteines for receptor binding and activation ( 29 ). This suggests conserved structural features may underlie ligand recognition by rGCs across species. In a striking parallel, NPs in vertebrates also regulate water homeostasis by activating cGMP signaling and promoting natriuresis and diuresis ( 29 ). Considering the concept of ligand/receptor co-evolution, the phylogenetic distributions of saITP and its primary receptor would be predicted to be similar, which we have confirmed for Gyc76C ( Fig. 2C ). Likewise, both would likely show similar loss-of-function phenotypes, and we have found this to be the case for saITP and Gyc76C, loss of either of which induces larval lethality. Despite these findings, we acknowledge that further evidence is required to conclude that Gyc76C is a bona fide saITP receptor. Although we did find that saITP application increased cGMP levels in S2 cells overexpressing Gyc76C , it did not increase cGMP levels in mammalian HEK293T cells expressing the same receptor under our assay conditions, even at same ligand concentration. Because a recent study reported that HEK293T cells expressing Gyc76C responded to saITP ( 46 ), it is possible that the discrepancy arises from lower sensitivity of our assay system. Nevertheless, it appears that S2 and HEK293T cells differ in their responsiveness to saITP. Moreover, saITP increased cGMP levels in ex vivo cultured hindguts but not in fat-body tissues, despite both tissues’ expressing Gyc76C . These results suggest that Gyc76C alone is insufficient for saITP signaling and that additional co-receptors or cofactors are required in a tissue-or cell-type-specific manner. Some rGCs in the nematode Caenorhabditis elegans function as heterodimers ( 47 ), raising the possibility that Gyc76C may likewise form functional heterodimers with other rGCs. In the vertebrate retina, guanylate cyclase-activating proteins act as essential cofactors for rGC activation ( 48 ), suggesting that similar accessory proteins may be required for Gyc76C function. It is also possible that saITP binds directly to a non-rGC receptor that then itself interacts with Gyc76C to transduce downstream cGMP signals. Indeed, some CHH-family peptides, including saITP, reportedly induce production of not only cGMP but also cAMP as second messengers ( 24 , 41 ), suggesting the involvement of receptors of other families. In conclusion, our study demonstrates that saITP functions as a neuroendocrine factor regulating systemic water balance through Gyc76C in the hindgut. Our findings uncover a brain-hindgut axis critical for osmoregulation, and they provide a conceptual framework for understanding the evolution and function of neuroendocrine water balance regulation in terrestrial arthropods. Materials and Methods Fly stocks The following lines were obtained from the Bloomington Drosophila Stock Center (BDSC, Indiana University, USA): Cg-GAL4 (stock #7011), CG30340 attP (#84473), Df(2R)ED4061 (#9068; used as a ITP Df strain), Df(3L)Exel6135 (#7614; used as a Gyc76C Df strain), R12G03-GAL4 (#48522), R57C10 (nSyb)-GAL4 (#90854), TkR99D attP (#84581), TubP-GAL4 (#5138), TubP-GAL80 TS (#7019), UAS-CG3216 RNAi (#55895), UAS-CG31183 RNAi (#56937), UAS-CG33958 RNAi (#30507), UAS-CG34357 RNAi (#28524), UAS-EHR ( CG10738 ) RNAi #1 (#28580; unless otherwise noted, this strain was used in all EHR RNAi experiments), UAS-EHR ( CG10738 ) RNAi #2 (#57318), UAS-Gyc76C RNAi #1 (#28660; unless otherwise noted, this strain was used in all Gyc76C RNAi experiments), UAS-Gyc76C RNAi #2 (#57315), UAS-mCD8::GFP (on 3rd chromosome; #5130), UAS-mCD8::GFP (on 2nd chromosome; #5137), and w 1118 (the control strain; #5905). UAS-Dicer-2 (stock #60009) and UAS-ITP shRNA (#330029; unless otherwise noted, this strain was used in all ITP RNAi experiments) were obtained from the Vienna Drosophila Resource Center (VDRC, Austria). Myo1A-GAL4 (stock #112001) and NP1093-GAL4 (#103880) were obtained from the Kyoto Stock Center (Department of Drosophila Genomics and Genetic Resources, Kyoto Institute of Technology, Japan). UAS-Gyc32E RNAi (stock #HMJ23918) was obtained from the National Institute of Genetics (NIG, Japan). byn-GAL4 ( 49 ) was obtained from Kenji Matsuno (Osaka University). tsh(c724)-GAL4 ( 50 ) and Uro-GAL4 ( 51 ) were obtained from Kenneth V. Halberg (University of Copenhagen). Gyc76C::T2A::GAL4 was generated in-house ( 52 ). TM2/TM6B, Dfd-EGFP was obtained from Takashi Nishimura (Gunma University). Gyc76C 1 , ITP SK2-4 , saITP AW1 , saITP::2A::GAL4 , UAS-RedcGull , and UAS-tethered-saITP were generated in this study as described below. All fly stocks were maintained on standard fly food containing 5.5 g agar (Daishin #P700), 100 g glucose (Showa Sangyo), 40 g dry yeast (Asahi Beer #HB-P02), 90 g cornmeal (Sunny Maize #Yellow-No.4M), 3 mL propionic acid (Nacalai Tesque #29018-55), 3.5 mL 10% butylparaben (in 70% ethanol) (Nacalai Tesque #06327-15), and 1 L of water. Unless otherwise noted, all experiments were conducted under non-crowded conditions at 25 °C and a 12h:12h light:dark cycle. Flies carrying the TubP-GAL80 TS transgene, which encodes a temperature-sensitive inhibitor of GAL4 activity, were reared at 17 °C until the second instar and then transferred to 29 °C immediately after third instar ecdysis to induce RNAi from third instar. Unless otherwise specified, the offspring from crosses between w 1118 and either a mutant strain, a GAL4 line, or a UAS-RNAi line were used as controls. Cell lines S2 cells were maintained in 25-cm 2 cell-culture flasks (NEST #707003) in a humidified incubator at 25 °C in Schneider’s Drosophila medium (SDM; Thermo Fisher Gibco #21720024) containing 10% fetal bovine serum (FBS; Thermo Fisher Gibco #10270-106) and 1% Penicillin-streptomycin solution (P/S; Fujifilm Wako #168-23191). HEK293T cells obtained from Hiroaki Daitoku (University of Tsukuba) were maintained in Dulbecco’s Modified Eagle Medium (DMEM; Nacalai Tesque #08456-36) containing 10% FBS (Gibco #F7524) and 1% P/S (Nacalai Tesque #09367-34) in 100-mm Type-I-collagen-coated dishes (Iwaki #4020-010-MYP) in a humidified incubator at 37 °C under 5% CO 2 . Before seeding the cells on new plates, they were washed with Dulbecco’s phosphate-buffered saline (D-PBS; Nacalai Tesque #11482-15) and treated with 0.02% EDTA (Nacalai Tesque #15130-95). Generation of ITP mutants The ITP mutant allele ( ITP SK2-4 ) disrupting all splice variants was generated using the CRISPR/Cas9 as previously described ( 52 ). A 20-bp gRNA target sequence, 5’-GCGCAGCAACTTCTTCGACC-3’, was designed around the first coding exon of ITP . Forward and reverse 24-bp oligonucleotides with 20-bp target sequences were annealed to generate a double-stranded DNA molecule with 4-bp overhangs on each end. This was then inserted into a BbsI -digested pBFv-U6.2 vector ( 52 ). A transgenic strain carrying the vector was established through phiC31-mediated site-specific integration. The gRNA strain was then crossed to a nos-Cas9 strain, and their progeny were screened by genomic PCR and sequencing for the presence of a frameshift-causing indel. We chose one such line for further analysis and named it ITP SK2-4 . This line carries a frameshift mutation, a 2-bp deletion in the ITP exon as follows: 5’-GAAGCGCAGCAACTTCTT--ACCTGGAGTGCAAGGGCA-3’, wherein one hyphen denotes a single-nucleotide deletion. Generation of saITP isoform-specific mutants The saITP isoform-specific mutant ( saITP AW1 ) was generated using CRISPR/Cas9 as previously described ( 52 ). A 20-bp gRNA target sequence, 5’-GAACACAGGCAAGAATGCTT-3’, was designed around the initiation codon of the saITP coding DNA sequence (CDS; Fig. S6). Forward and reverse 24-bp oligonucleotides with 20-bp target sequences were annealed to generate a double-stranded DNA molecule with 4-bp overhangs on each end. This was then inserted into a BbsI -digested pBFv-U6.2 vector ( 52 ). The resulting saITP isoform-specific gRNA vector was injected into w 1118 ; nos-Cas9/TM6B fly embryos (WellGenetics, New Taipei City, Taiwan). Surviving G 0 males were crossed to 2nd chromosome Sp/SM6a virgin females, and their progeny were screened by genomic PCR and sequencing for the presence of frameshift-inducing indels. We chose one line for further analysis and named it saITP AW1 . This is a frameshift mutant carrying a 14-bp deletion starting at the second nucleotide of the saITP CDS, which disrupts the entire saITP amino-acid sequence (Fig. S6). Generation of saITP::T2A::GAL4 flies The saITP::T2A::GAL4 line was generated by CRISPR-mediated targeted integration of T2A::GAL4 immediately in front of the stop codon of saITP as previously described ( 53 ). A donor vector for targeted integration was generated by assembling the left and right homology arms and the T2A::GAL4/3xP3-RFP cassette in a single enzymatic reaction using In-Fusion (Takara). The left homology arm was amplified by the following primer set: F: 5’-GCTTGATATCGAATTCACGCAAGATCGCAATTTGTGCAAGACAC-3’ R: 5’-AGTTGGGGGCGTAGGCTTGCGACCCAGGGTATCGCGCCATTCG-3’. The right homology arm was amplified by the following primer set: F: 5’-TAGTATAGGAACTTCAGTGCGATTCTCTGGGATTTTCTGGCAC-3’ R: 5’-CGGGCTGCAGGAATTCCCGCAATCAAATTCGCTGTCGATTCCTC-3’. Underlined sequences above match the genomic DNA sequence, and the rest of the sequences are adapters for vector construction. The donor vector and a gRNA vector expressing the sequence 5’-GCAAGTAAAGTGCGATTCTC-3’ were co-injected into fertilized eggs of the nos-Cas9 strain to induce a site-specific double-strand break and subsequent integration of the donor vector. The injected embryos were raised to adulthood, and their progeny were screened for transformants marked by eye-specific RFP fluorescence. A single transformant was crossed to a TM6B balancer line to establish a stock. The “floxed” 3xP3-RFP marker was removed before use by crossing to a TM6B, Cre-w balancer line. Total RNA extraction and quantitative reverse transcription (qRT)-PCR Whole bodies or dissected tissues were collected in 1.5 mL tubes and immediately flash-frozen in liquid nitrogen. Total RNA from bodies or tissues was extracted as previously described ( 55 ). cDNA was generated from purified total RNA using ReverTra Ace qPCR RT Master Mix with gDNA Remover (TOYOBO #FSQ-301) according to the manufacturer’s instructions. qRT-PCR was performed on a CFX Duet Real-Time PCR machine (Bio-Rad) using Taq Pro Universal SYBR qPCR Master Mix (Vazyme #Q712-02). For absolute mRNA quantification, serial dilutions of pGEM-T (Promega #A362A) plasmids containing the coding sequences of a target gene or rp49 were used for standards. After the molar amounts were calculated, the transcript levels of each target mRNA were normalized to the levels of rp49 in the same samples. Three separate samples were collected for each experiment, and duplicate measurements were conducted. The primers to detect rp49 levels were previously reported ( 54 ), and the others are as follows: saITP -F: 5’-ACACCGATTATGCAAGCAAGAATGC-3’ saITP -R: 5’-TATCGCGCCATTCGTTATACTTGTC-3’ ITPL1 -F: 5’-ATCGACGATGAAGAGATATCGCAGC-3’ ITPL1 -R: 5’-AGTGGTCGAAGTTAGGAGTCTAGTG-3’ ITPL2 -F: 5’-ACAGCTGAGAATCGGTGCGAATATC-3’ ITPL2 -R: 5’-TTAGATTTCTGTGTTCTGGCTCTGC-3’ Gyc76C -F: 5’-TTCTGTACGAGGATGTGTGGAGTCC-3’ Gyc76C -R: 5’-AGCATCTGCTCACAGCACTTGACTC-3’ Analysis of larval survival and mortality Larval 24-hr survival rate was calculated based on the proportion of newly hatched larvae surviving the first 24 hrs after hatching. Newly hatched larvae were transferred to small food vials at a density of 25 larvae per vial. The vials were then maintained in a humidified incubator, and the number of surviving larvae was recorded after 24 hrs. Larval mortality was calculated based on the proportion of larvae that developed to the pupal stage as previously described ( 55 ). Newly hatched larvae were transferred to small food vials at a density of 25 larvae per vial and then maintained in a humidified incubator. The number of pupae that formed in each vial was recorded. Immunostaining Tissues were dissected in 1x PBS (Nacalai Tesque #27575-31), fixed with 4% paraformaldehyde (PFA; Nacalai Tesque #02890-45) in PBS (4% PFA/PBS) containing 0.3% Triton X-100 (Nacalai Tesque #35501-15) for 20 min at room temperature (RT) and then washed multiple times with PBS containing 0.3% Triton X-100 (PBST). Tissues were blocked with 2% bovine serum albumin (BSA; Sigma-Aldrich #A9647) in PBST for at least 1 hr at RT, incubated overnight at 4 °C with primary antibodies mixed in PBST containing 2% BSA, washed multiple times with PBST, incubated for 2 hrs at RT with secondary antibodies in PBST containing 2% BSA, and again washed multiple times with PBST. When appropriate, DAPI (Sigma-Aldrich #D9542) nuclear stain was diluted 1:2,000 into the secondary-antibody mixture. After washing, the tissues were mounted in Vectashield H-1000 (Vector Laboratories) and observed using a Zeiss Axio Imager M2 equipped with ApoTome.2 or a Zeiss LSM 900 confocal microscope. The specificity of the signals was established by comparison with appropriate controls. Chicken anti-GFP (1:2,000 dilution, Abcam #ab13970) and guinea pig anti-saITP (1:1000 dilution; ref. 57) were used as primary antibodies. Alexa Fluor 488 goat anti-chicken (1:2,000 dilution, Thermo Fisher Scientific #A32931) and Alexa Fluor 488 goat anti-guinea pig (1:2,000 dilution, Thermo Fisher Scientific #A11073) were used as secondary antibodies. Phylogenetic tree analysis We generated neighbor-joining trees using ClustalW ( https://www.genome.jp/tools-bin/clustalw ). We aligned the amino acid sequences of seven D. melanogaster rGCs to 58 rGCs from vertebrates (Human, Homo sapiens ; Mouse, Mus musculus ; Zebrafish, Danio rerio ), holometabolous insects (yellow fever mosquito, Aedes aegypti ; silk moth, Bombyx mori ; red flour beetle, Tribolium castaneum ; western honey bee, Apis mellifera ), a hemimetabolous insect (human body louse, Pediculus humanus ), and a crustacean (water flea, Daphnia pulex ). Protein names and GenBank accession numbers are listed in Table S1. Construction of plasmids for transfection pUAST-Gyc76C , pcDNA-Gyc76C , and pUAST-EHR plasmids were constructed from cDNA clones LD12174 (for Gyc76C ) and IP14815 (for EHR ), which were obtained from the Drosophila Genomic Resource Center (DGRC, Indiana University, USA). These cDNA clones were used as templates for PCR amplification using KOD Plus Neo (TOYOBO #KOD-401). The resulting PCR products were cloned into Eco RI- and Xba I-digested pUAST vector or pcDNA3.0 vector using the In-Fusion HD Cloning Kit (Takara #102518) according to the manufacturer’s instructions. pUAST-Gyc76C-ΔLBD was constructed from a cDNA clone generated by Twist Bioscience (San Francisco, USA). The domain organization of Gyc76C was predicted using InterPro ( https://www.ebi.ac.uk/interpro/ ) and used to design a Gyc76C-ΔLBD sequence lacking the predicted LBD (glycine 48 to proline 424, numbered from the initiator methionine). The Gyc76C-ΔLBD sequence was cloned into Eco RI- and Xba I-digested pUAST vector using the In-Fusion HD Cloning Kit according to the manufacturer’s instructions. The primers used were as follows: pUAST-EHR -F: 5’-AGGGAATTGGGAATTAGCAGCATTTCACGCGATTC-3’ pUAST-EHR -R: 5’-ACAAAGATCCTCTAGAGGACACTGCCTTAAACCTC-3’ pUAST-Gyc76C -F: 5’-AGGGAATTGGGAATTTCGCTGTGAGAATCCGTTGG-3’ pUAST-Gyc76C -R: 5’-ACAAAGATCCTCTAGCTACACTGCCTTCTCCTTAT-3’ pUAST-Gyc76C-ΔLBD -F: 5’-AGGGAATTGGGAATTATGACGCGTTGGCCCTTTAA-3’ pUAST-Gyc76C-ΔLBD -R: 5’-ACAAAGATCCTCTAGCTATACTATACTCTCACGAT-3’ pcDNA3-Gyc76C -F: 5’-AGTGTGCTGGAATTTCGCTGTGAGAATCCGTTGG-3’ pcDNA3-Gyc76C -R: 5’-ATAGGGCCCTCTAGCTACACTGCCTTCTCCTTAT-3’ Generation of ITP double-stranded (ds) RNA For dsRNA preparation, the 20-bp T7 promoter sequence (underlined) was attached to the 5′ end of the ITP -specific PCR primers as follows: F: 5’- GGATCCTAATACGACTCACTATAGG ACCACAACCAGCGATAAGCATCCG-3’ R: 5’- GGATCCTAATACGACTCACTATAGG AACAACTGGTAGCAGTCCTCGCAG-3’ Whole-body cDNA was used as a PCR template. The resulting PCR product carrying the T7 promoter sequences was used as a template for in vitro transcription using the RiboMAX Express RNAi System (Promega #P1700) according to the manufacturer’s instructions. Generation of synthetic peptides Mature Drosophila saITP peptide, comprising 73 amino acid residues (NH 2 -SNFFDLECKGIFNKTMFFRLDRICEDCYQLFRETSIHRLCKQECFGSPFFNACIEALQLHEEM DKYNEWRDTL-CONH 2 ), was synthesized using fluorenylmethyloxycarbonyl (Fmoc) chemistry and microwave-assisted solid-phase peptide synthesis using a Initiator+ Alstra automated peptide synthesizer (Biotage, Uppsala, Sweden) as previously described ( 57 ). The refolding of saITP was performed as previously described ( 58 ). High-performance liquid chromatography (HPLC) was used to confirm a purity >95% for the synthesized saITP. Lyophilized saITP was weighed on an analytical balance (AP125WD; Shimadzu, Kyoto, Japan). Mature Drosophila NPLP1-VQQ peptide (NH 2 -NLGALKSSPVHGVQQ-COOH) was synthesized by Eurofins Genomics (Tokyo, Japan). Transfection and cGMP assay in culture cells Just prior to transfection, S2 cells were seeded at a density of 5×10 5 cells/mL into 35-mm cell-culture dishes (Greiner #627160) in 2 mL of SDM containing 10% FBS and 1% P/S. S2-cell transfection was performed using the Effectene transfection reagent (QIAGEN #301425) according to the manufacturer’s instructions. Each dish was transfected with 0.3 μg pUAST empty vector (as a control) or pUAST-rGC ( pUAST-Gyc76C , pUAST-EHR , or pUAST-Gyc76C-ΔLBD ) along with 0.1 μg of pActin-GAL4 . For the ITP RNAi experiments, 10 μg of ITP dsRNA was added to each dish at the time of transfection and again every 24 hrs afterward. The cells were incubated for three days after transfection. Then, 500 μL/well of transfected cells were transferred to a 24-well plate (TPP #92424). After 4 hrs of incubation, 50 μL of the medium in each well was removed and replaced with 50 μL of 10-mM 3-isobutyl-1-methylxanthine (IBMX) (Adipogen Life Sciences #AG-CR1-3512-M500) to reach the final concentration of 1 mM. After a 30-min incubation, 50 μL of the medium in each well was removed and replaced with 50 μL of SDM (as a vehicle control) or synthetic mature saITP stock, for the final concentration of 100 nM, or mature Nplp1-VQQ (at the final concentration of 1 μM) in SDM. After another 30-min incubation, the medium was removed and replaced with 500 μL of 0.1-M HCl to lyse the cells. After a 10-min incubation at RT, the cell lysates were collected and stored at -80 °C. Just prior to transfection, HEK293T cells were seeded at a density of 5×10 5 cells/mL into 35-mm collagen-coated dishes (Iwaki #4000-010-MYP) in 2 mL of DMEM containing 10% FBS and 1% P/S. HEK293T cells were transfected with 0.4 μg/dish of pcDNA3.0 empty vector (as control) or pcDNA-Gyc76C , using the Effectene transfection reagent according to the manufacturer’s instructions. Three days after transfection, the transfected cells were washed with D-PBS, treated with 0.02% EDTA, and resuspended in 2 mL of DMEM containing 10% FBS and 1% P/S. Cells were re-seeded at 500 μL /well in a 24-well collagen-coated plate (Iwaki #4820-010). After a 4-hr incubation, 50 μL of the medium in each well was replaced with 50 μL of 10 mM IBMX to attain the final concentration of 1 mM. After a 30-min incubation, another 50 μL of the medium in each well was replaced with 50 μL of DMEM (as a vehicle control) or mature saITP peptide (at the final concentration of 100 nM) in DMEM. Finally, after a 30-min incubation, the medium was removed, and 500 μL of 0.1 M HCl was added to each well to lyse the cells. After a 10-min incubation at RT, the cell lysates were collected and stored at -80 °C. After cell lysis, cGMP levels were determined using a cGMP ELISA Kit (Cayman #581021) according to the manufacturer’s instructions, with indicator levels measured using a Multiskan GO spectrophotometer (ThermoFisher Scientific). Generation of Gyc76C mutant flies The Gyc76C 1 mutant allele was generated using the CRISPR/Cas9 as previously described ( 52 ). Pairs of gRNA target sequences (20 bp) were designed near the Gyc76C translational start (T1: 5’-GGATTGTGTTGGCGTGGACA-3’) and stop sites (T2: 5’-GAAGAAGGAGCAGGATGACC-3’). Forward and reverse 24-bp oligonucleotides with 20-bp target sequences were annealed to generate a double-stranded DNA with 4-bp overhangs on each end. This was then inserted into BbsI -digested pBFv-U6.2 or pBFv-U6.2B vector ( 52 ). To construct a double-gRNA vector, the first gRNA (T1) was cloned into pBFv-U6.2 (named pBFv-U6.2-T1). Then, the second gRNA (T2) was cloned into pBFv-U6.2B (named pBFv-U6.2B-T2). A fragment containing the U6 promoter and the first gRNA was cut from pBFv-U6.2-T1 and ligated into pBFv-U6.2B-T2. This Gyc76C double-gRNA vector was then injected into yw; nos-Cas9[attP40]/CyO fly embryos (BestGene Inc, CA, USA). Surviving G 0 males were divided into 10 groups and crossed en masse to 3rd chromosome balancer virgins (TM2/TM6B, Dfd-EGFP) . Five individual males were isolated from the progeny of each of these ten crosses and crossed independently to TM2/TM6B, Dfd-EGFP virgins to establish independent isogenized lines. Among the resulting 50 lines, those with homozygous lethality were isolated. To confirm deletions at the Gyc76C locus, we randomly selected 5 lines and performed genomic PCR and sequencing. We confirmed complete deletions in all five lines and chose one line for further analysis, naming it Gyc76C 1 . Gyc76C 1 has a 7,403-bp deletion that includes the entire Gyc76C coding DNA sequence (CDS). Generation of UAS-RedcGull transgenic flies A codon-optimized RedcGull cassette (Fig. S7) comprising an Eco RI cut site, Drosophila Kozak sequence, Drosophila -optimized RedcGull coding sequence, and Xba I cut site was synthesized and sequence-verified by GeneArt Services (Thermo Fisher Scientific, MA, USA). This cassette was cloned into Eco RI-and Xba I-digested pUAST-attB vector. This pUAST-attB-RedcGull construct was inserted into the VK00018 attP site on chromosome 2R via phiC31 integrase-mediated transgenesis (BestGene Inc, CA, USA). cGMP imaging analysis of ex vivo cultured tissues cGMP imaging analysis of ex vivo cultured tissues was performed using flies expressing UAS-RedcGull under the control of tissue-specific GAL4 drivers ( i.e. , byn-GAL4 for the hindgut and Cg-GAL4 for the fat body). Tissues were dissected from wandering third instar in SDM with 10% FBS and 1% P/S and then washed with SDM. The dissected tissues were kept in a glass-bottomed dish (35×10 mm, IWAKI, #3910-035) with insect pins (ϕ0.10 mm, Ento Sphinx Insect Pins) and silicone grease (Beckman) covered with 20 μL of SDM. Live imaging was performed at RT using a Zeiss LSM 900 confocal microscope. RedcGull was excited with a 555-nm laser. Time-lapse images were acquired every 20 seconds for 420 seconds. Then, 120 seconds after starting live-imaging, 80 μL of SDM with or without 100 nM synthetic saITP was added to the tissue. Mean fluorescence intensities were measured along the time axis using Fiji (ImageJ2, v2.16.0) and R (v4.4.2). Generation of UAS-tethered-saITP transgenic flies Because saITP is amidated on its C-terminal end, we chose to create a membrane-tethered saITP by fusing a transmembrane domain to the N terminus of the predicted secreted form of saITP. To do this, we adapted a technique first described for constructing tethered-Bursicon constructs ( 59 , 60 ). A transmembrane domain known to function in a “type-2” orientation ( i.e. , with an intracellular N terminus and extracellular C terminus) was fused between an N-terminal mTagBFP2 fluorophore with an extracellular spacer sequence and the saITP domain (Fig. S8). Since saITP relies on disulfide bridges to retain proper structure, no other cysteine residues were included in the extracellular sequence to promote proper folding. The amino-acid sequence (Fig. S8) of the construct was reverse-translated and codon-optimized for D. melanogaster . A codon-optimized tethered-saITP cassette (Fig. S8) comprising an Eco RI cut site, Drosophila Kozak sequence, Drosophila -optimized tethered-saITP coding sequence, and Xba I cut site was synthesized and sequence-verified by GeneArt Services (Thermo Fisher Scientific, MA, USA). This cassette was cloned into Eco RI-and Xba I-digested pUAST-attB vector. Then, the pUAST-attB tethered-saITP plasmid was inserted into the attP40 site on chromosome 2L via phiC31 integrase-mediated transgenesis (BestGene Inc, CA, USA). Ex vivo fluid-reabsorption assay Water reabsorption in the hindgut was assessed using an ex vivo culture protocol modified slightly from one previously described ( 44 , 45 , 61 ). Embryos were collected on apple-juice plates with a small amount of yeast paste for 4 hrs at 25 °C. The plates were then transferred to 18 °C and incubated for an additional 48 hrs, after which newly hatched first-instar larvae were collected and transferred to standard fly-food vials (30-35 per vial). Around 100 hrs after larval selection, all the vials were shifted to 29 °C. Large actively feeding mid-third instar larvae were used for reabsorption assays. Larvae were thoroughly washed twice with MilliQ water. Then, in SDM, the cuticle and fat body were carefully removed without disturbing the CNS complex, gut, Malpighian tubules, or hindgut. The tracheal trunks were cut to facilitate mounting. It is important to note that the posterior cuticle was carefully removed apart from the posterior spiracles, while the anterior cuticle around the mouthparts was retained to enable pinning. After removing residual SDM, the dissected organ complex was gently transferred to a paraffin-wax dish filled with water-saturated paraffin oil (Sigma-Aldrich #18512). To preserve the foregut, midgut, hindgut, and tubules, the complex was gently stretched and pinned at the anterior cuticle and posterior spiracles. Any excess SDM was removed using a pipette. Two drops of assay medium [1:1 premixed HL3.1 saline ( 62 ) and SDM supplemented with 100 µM of the red dye amaranth (Sigma-Aldrich #A1016) in DMSO] were added under paraffin oil. One drop (2 µL) was placed around the midgut and tubules, and a second smaller 0.3 µL drop—either with or without 100 nM saITP—was placed near the hindgut (while avoiding the posterior spiracles). The tubules were gently drawn away from the large drop and wrapped around a pin using fine forceps. The circumference of the smaller droplet was measured using an eyepiece graticule (Leica, Germany). Specimens were excluded from further analysis if they lacked any of the following: ( 1 ) gut peristaltic contractions within one min of adding the assay medium, ( 2 ) pigmentation of the tubules (indicating a lack of amaranth uptake), or ( 3 ) enlargement of the posterior droplet. These were rare under control conditions ( byn ts > w 1118 with no saITP application). One hr after droplet placement, changes in the circumference of the initial and final drops were converted to volumes using the following equation: V = (π x d 3 )/6. Then, the rate of absorption (nl/min) was calculated as Δv/Δt, where Δv is the change in volume (nl) and Δt is the duration (min) of the experiment. Quantification of body water volume Larval wet weight was measured by individually weighing actively feeding third instar larvae in 0.2 mL PCR tubes on an ultra-microbalance (Sartorius, SE2). After weighing, the larvae were instantly killed on dry ice, transferred to a 60 °C oven, and dried for 36 hrs. The dried larvae were re-weighed to assess the amount of water lost. Body water volume was calculated as percent water using the following formula: 100 x ([wet weight] - [dry weight]) / [wet weight]. Hemolymph collection and osmolality measurement For hemolymph collection, third instar larvae were rinsed in water, gently blotted dry, and placed in a clean glass dish on ice. The cuticle was nicked with fine tweezers, carefully avoiding damaging internal tissues such as the gut to prevent contamination. The exuding hemolymph was immediately collected by pipette into pre-chilled Eppendorf tubes on ice, and hemolymph from multiple larvae was pooled. To limit melanization, samples were heat-treated at 70 °C for 5 min before being frozen. To purify the hemolymph for osmolarity measurements, samples were thawed and centrifuged to remove circulating cells (top speed, 5 min) at 4 °C, and the clarified supernatant was used for osmometry. Osmolarity was measured by using 10 µL of hemolymph per sample on a vapor-pressure osmometer (VAPRO model 5600, ELITechGroup) calibrated to manufacturer standards. Sampling and loading were performed rapidly to minimize evaporation; each biological replicate corresponded to one pooled hemolymph sample. Quantification of body weight After puparium formation, intact pupae were carefully cleaned using distilled water and a paintbrush and then completely dried on paper towels. Clean, surface-dry (not dehydrated) pupae were individually weighed on an ultra-microbalance (Sartorius, SE2). Author Contributions N.O. conceived the study. A.W., T.K., O.K., M.J.T., K.R., R.N., and N.O designed the experiments and interpreted the data. A.W. performed most of the experiments and analyzed the data with contributions from T.K., O.K., M.J.T., K.R., R.N., and N.O. S.K. contributed to the generation of ITP SK2-4 and saITP::T2A::GAL4 . A.W. and N.O. contributed to the generation of saITP AW1 . R.M., N.O., and N.Y. contributed to the generation of Gyc76C 1 . T.K., O.K., M.J.T., and K.R. contributed to the generation of UAS-RedcGull and UAS-tethered-ITP . M.F., E.I-U., and K.U. contributed to the synthesis of the saITP peptide. T.Y. contributed to the generation of the anti-saITP antibody. A.W. and N.O. wrote the manuscript with contributions from T.K., O.K., M.J.T., H.T., S.K., N.Y., K.U., K.R., and R.N. N.O. supervised the project. Corresponding authors Correspondence to Naoki Okamoto. Competing interests The authors declare no competing interests. Acknowledgements We thank the Vienna Drosophila Resource Center, the Bloomington Drosophila Stock Center, the National Institute of Genetics Fly Stock Center, the Kyoto Stock Center, the Transgenic RNAi Project at Harvard Medical School, K. Matsuno, T. Nishimura, K.V. Halberg, and H. Tanimoto for fly stocks; H. Daitoku for cell lines; FlyBase for providing comprehensive and invaluable resources on Drosophila ; K.V. Halberg for access to the vapor-pressure osmometer; K.V. Halberg, M. Gáliková, and D. Žitňan for helpful discussions; and Write Labs ( https://write-labs.com ) for help with editing the manuscript. This study was supported by the Japan Science and Technology Agency (JST) FOREST Program (JPMJFR224M), the Japan Society for the Promotion of Science (JSPS) KAKENHI Grant-in-Aid for Scientific Research (B) (25K02307) to N.O., the JSPS KAKENHI Grant-in-Aid for JSPS Fellow (24KJ0466), the JST SPRING Program (JPMJSP2124) to A.W., and the Independent Research Fund Denmark (DFF) (4283-00022B) to K.R. A.W. is the recipient of a fellowship from the Japan Society for the Promotion of Science. Funder Information Declared Japan Science and Technology Agency , JPMJFR224M , JPMJSP2124 Japan Society for the Promotion of Science , 25K02307 , 24KJ0466 Independent Research Fund Denmark , 4283-00022B References 1. ↵ Y. Zhang , Y. Oka , Body fluid regulation . Curr. Opin. Neurobiol. 92 , 103017 ( 2025 ). OpenUrl PubMed 2. ↵ J. Antunes-Rodrigues , et al. , Neuroendocrine control of body fluid metabolism . Physiol. Rev . 84 , 169 – 208 ( 2004 ). OpenUrl CrossRef PubMed Web of Science 3. ↵ K. V. Halberg , B. Denholm , Mechanisms of systemic osmoregulation in insects . Annu. Rev. Entomol . 69 , 415 – 438 ( 2024 ). OpenUrl PubMed 4. M. J. O’Donnell , A perspective on insect water balance . J. Exp. Biol . 225 , jeb242358 ( 2022 ). OpenUrl CrossRef PubMed 5. ↵ J. B. Benoit , K. E. McCluney , M. J. DeGennaro , J. A. T. Dow , Dehydration dynamics in terrestrial Arthropods: from water sensing to trophic interactions . Annu. Rev. Entomol . 68 , 129 – 149 ( 2023 ). OpenUrl CrossRef PubMed 6. ↵ H. Dircksen , Insect ion transport peptides are derived from alternatively spliced genes and differentially expressed in the central and peripheral nervous system . J. Exp. Biol . 212 , 401 – 412 ( 2009 ). OpenUrl Abstract / FREE Full Text 7. ↵ S. G. Webster , R. Keller , H. Dircksen , The CHH-superfamily of multifunctional peptide hormones controlling crustacean metabolism, osmoregulation, moulting, and reproduction . Gen. Comp. Endocrinol . 175 , 217 – 233 ( 2012 ). OpenUrl CrossRef PubMed 8. ↵ N. Audsley , C. Mcintosh , J. E. Phillips , Isolation of a neuropeptide from locust corpus cardiacum which influences ileal transport . J. Exp. Biol . 173 , 261 – 274 ( 1992 ). OpenUrl Abstract / FREE Full Text 9. N. Audsley , C. Mcintosh , J. E. Phillips , Actions of ion-transport peptide from locust corpus cardiacum on several hindgut transport processes . J. Exp. Biol . 173 , 275 – 288 ( 1992 ). OpenUrl Abstract / FREE Full Text 10. ↵ J. Meredith , et al. , Locust ion transport peptide (ITP): primary structure, cDNA and expression in a baculovirus system . J. Exp. Biol . 199 , 1053 – 1061 ( 1996 ). OpenUrl Abstract / FREE Full Text 11. ↵ M. Gáliková , H. Dircksen , D. R. Nässel , The thirsty fly: ion transport peptide (ITP) is a novel endocrine regulator of water homeostasis in Drosophila . PLoS Genet . 14 , e1007618 ( 2018 ). OpenUrl CrossRef PubMed 12. ↵ K. Begum , B. Li , R. W. Beeman , Y. Park , Functions of ion transport peptide and ion transport peptide-like in the red flour beetle Tribolium castaneum . Insect Biochem. Mol. Biol . 39 , 717 – 725 ( 2009 ). OpenUrl CrossRef PubMed 13. H. A. D. Johard , et al. , Peptidergic clock neurons in Drosophila : ion transport peptide and short neuropeptide F in subsets of dorsal and ventral lateral neurons . J. Comp. Neurol . 516 , 59 – 73 ( 2009 ). OpenUrl CrossRef PubMed Web of Science 14. C. Hermann-Luibl et al. , The ion transport peptide is a new functional clock neuropeptide in the fruit fly Drosophila melanogaster . J. Neurosci . 34 , 9522 – 9536 ( 2014 ). OpenUrl Abstract / FREE Full Text 15. ↵ B. Yu , et al. , Ion transport peptide (ITP) regulates wing expansion and cuticle melanism in the brown planthopper, Nilaparvata lugens . Insect Mol. Biol . 25 , 778 – 787 ( 2016 ). OpenUrl CrossRef PubMed 16. ↵ M. Gáliková , P. Klepsatel , Ion transport peptide regulates energy intake, expenditure, and metabolic homeostasis in Drosophila . Genetics 222 , iyac150 ( 2022 ). OpenUrl CrossRef PubMed 17. ↵ W. Xu et al. , A novel antidiuretic hormone governs tumour-induced renal dysfunction . Nature 624 , 425 – 432 ( 2023 ). OpenUrl CrossRef PubMed 18. ↵ Z. Zhu , S. Nagata , Ion transport peptide and ion transport peptide-like regulate ecdysis behavior and water transport during ecdysis in Gryllus bimaculatus . Insect Biochem. Mol. Biol . 173 , 104178 ( 2024 ). 19. ↵ F. Sajadi , J.-P. V. Paluzzi , Molecular characterization, localization, and physiological roles of ITP and ITP-L in the mosquito , Aedes aegypti. Front. Insect Sci . 4 , 1374325 ( 2024 ). 20. ↵ G.-Y. Long , et al. , Wing expansion functional analysis of ion transport peptide gene in Sogatella furcifera (Horváth) (Hemiptera: Delphacidae) . Comp. Biochem. Physiol. B. Biochem. Mol. Biol . 271 , 110946 ( 2024 ). 21. ↵ M. Ring , et al. , Expression of Schistocerca gregaria ion transport peptide (ITP) and its homologue (ITP-l) in a baculovirus/insect cell system . Insect Biochem. Mol. Biol . 28 , 51 – 58 ( 1998 ). OpenUrl CrossRef PubMed 22. ↵ M. F. Goy , Activation of membrane guanylate cyclase by an invertebrate peptide hormone . J. Biol. Chem . 265 , 20220 – 20227 ( 1990 ). OpenUrl Abstract / FREE Full Text 23. ↵ J. S. Chung , S. G. Webster , Binding sites of crustacean hyperglycemic hormone and its second messengers on gills and hindgut of the green shore crab, Carcinus maenas : a possible osmoregulatory role . Gen. Comp. Endocrinol . 147 , 206 – 213 ( 2006 ). OpenUrl CrossRef PubMed 24. ↵ H.-Y. Chen , J.-Y. Toullec , C.-Y. Lee , The crustacean hyperglycemic hormone superfamily: progress made in the past decade . Front. Endocrinol (Lausanne ). 11 , 578958 ( 2020 ). 25. ↵ C. Nagai , H. Mabashi-Asazuma , H. Nagasawa , S. Nagata , Identification and characterization of receptors for ion transport peptide (ITP) and ITP-like (ITPL) in the Silkworm Bombyx mori . J. Biol. Chem . 289 , 32166 – 32177 ( 2014 ). OpenUrl Abstract / FREE Full Text 26. ↵ C. Nagai-Okatani , H. Nagasawa , S. Nagata , Tachykinin-related peptides share a G protein-coupled receptor with ion transport peptide-like in the silkworm Bombyx mori . PLoS ONE 11 , e0156501 ( 2016 ). OpenUrl PubMed 27. ↵ H. Dircksen , L. K. Tesfai , C. Albus , D. R. Nässel , Ion transport peptide splice forms in central and peripheral neurons throughout postembryogenesis of Drosophila melanogaster . J. Comp. Neurol . 509 , 23 – 41 ( 2008 ). OpenUrl CrossRef PubMed 28. ↵ R. T. Birse , E. C. Johnson , P. H. Taghert , D. R. Nässel , Widely distributed Drosophila G-protein-coupled receptor (CG7887) is activated by endogenous tachykinin-related peptides . J. Neurobiol . 66 , 33 – 46 ( 2006 ). OpenUrl CrossRef PubMed Web of Science 29. ↵ M. Kuhn , Molecular physiology of membrane guanylyl cyclase receptors . Physiol. Rev . 96 , 751 – 804 ( 2016 ). OpenUrl CrossRef PubMed 30. C. Laschet , N. Dupuis , J. Hanson , The G protein-coupled receptors deorphanization landscape . Biochem. Pharmacol . 153 , 62 – 74 ( 2018 ). OpenUrl CrossRef PubMed 31. ↵ R. Trenker , N. Jura , Receptor tyrosine kinase activation: From the ligand perspective . Curr. Opin. Cell Biol . 63 , 174 – 185 ( 2020 ). OpenUrl CrossRef PubMed 32. ↵ G. Kegel , et al. , Amino acid sequence of the crustacean hyperglycemic hormone (CHH) from the shore crab, Carcinus maenas . FEBS Lett . 255 , 10 – 14 ( 1989 ). OpenUrl CrossRef PubMed Web of Science 33. ↵ J. E. Phillips , et al. , Locust ion transport peptide (ITP): a putative hormone controlling water and ionic balance in terrestrial insects . Am. Zool . 38 , 461 – 470 ( 1998 ). OpenUrl CrossRef 34. ↵ L. Verbakel et al. , Essential role of eclosion hormone precursor and receptor genes in desert locust ecdysis . J. Insect Physiol . 161 , 104736 ( 2025 ). 35. ↵ V. Silva , et al. , Characterization of eclosion hormone receptor function reveals differential hormonal control of ecdysis during Drosophila development . PLoS Genet . 21 , e1011672 ( 2025 ). OpenUrl PubMed 36. ↵ J.-C. Chang , R.-B. Yang , M. E. Adams , K.-H. Lu , Receptor guanylyl cyclases in Inka cells targeted by eclosion hormone . Proc. Natl. Acad. Sci. U.S.A . 106 , 13371 – 13376 ( 2009 ). OpenUrl Abstract / FREE Full Text 37. ↵ S. L. McNabb , et al. , Disruption of a behavioral sequence by targeted death of peptidergic neurons in Drosophila . Neuron 19 , 813 – 823 ( 1997 ). OpenUrl CrossRef PubMed Web of Science 38. ↵ E. Krüger , W. Mena , E. C. Lahr , E. C. Johnson , J. Ewer , Genetic analysis of eclosion hormone action during Drosophila larval ecdysis . Development dev . 126995 ( 2015 ). 39. ↵ D. S. King , J. Meredith , Y. J. Wang , J. E. Phillips , Biological actions of synthetic locust ion transport peptide (ITP) . Insect Biochem. Mol. Biol . 29 , 11 – 18 ( 1999 ). OpenUrl CrossRef PubMed Web of Science 40. ↵ R. Mettulio et al. , Functional analysis of crustacean hyperglycemic hormone by in vivo assay with wild-type and mutant recombinant proteins . Regulatory Peptides 119 , 189 – 197 ( 2004 ). OpenUrl PubMed 41. ↵ N. Audsley , D. Jensen , D. A. Schooley , Signal transduction for Schistocerca gregaria ion transport peptide is mediated via both cyclic AMP and cyclic GMP . Peptides 41 , 74 – 80 ( 2013 ). OpenUrl CrossRef PubMed 42. ↵ G. Overend , et al. , The receptor guanylate cyclase Gyc76C and a peptide ligand, NPLP1-VQQ, modulate the innate immune IMD pathway in response to salt stress . Peptides 34 , 209 – 218 ( 2012 ). OpenUrl CrossRef PubMed Web of Science 43. ↵ M. Takizawa , et al. , Development of a red fluorescent protein-based cGMP indicator applicable for live-cell imaging . Commun Biol 5 , 833 ( 2022 ). 44. ↵ M. K. Andersen , J. Overgaard , Maintenance of hindgut reabsorption during cold exposure is a key adaptation for Drosophila cold tolerance . J. Exp. Biol . 223 , jeb.213934 ( 2020 ). OpenUrl 45. ↵ M. T. Naseem , et al. , NHA1 is a cation/proton antiporter essential for the water-conserving functions of the rectal complex in Tribolium castaneum . Proc. Natl. Acad. Sci. U.S.A . 120 , e2217084120 ( 2023 ). OpenUrl CrossRef PubMed 46. ↵ J. Gera , et al. , Anti-diuretic hormone ITP signals via a guanylate cyclase receptor to modulate systemic homeostasis in Drosophila . eLife 13 , RP97043 ( 2024 ). OpenUrl 47. ↵ N. D. L’Etoile , C. I. Bargmann , Olfaction and odor discrimination are mediated by the C. elegans guanylyl cyclase ODR-1 . Neuron 25 , 575 – 586 ( 2000 ). OpenUrl CrossRef PubMed Web of Science 48. ↵ K. Palczewski , I. Sokal , W. Baehr , Guanylate cyclase-activating proteins: structure, function, and diversity . Biochem. Biophys. Res. Commun . 322 , 1123 – 1130 ( 2004 ). OpenUrl CrossRef PubMed Web of Science 49. ↵ D. D. Iwaki , J. A. Lengyel , A Delta–Notch signaling border regulated by Engrailed/Invected repression specifies boundary cells in the Drosophila hindgut . Mech. Dev . 114 , 71 – 84 ( 2002 ). OpenUrl CrossRef PubMed Web of Science 50. ↵ D. Feingold , et al. , secCl is a cys-loop ion channel necessary for the chloride conductance that mediates hormone-induced fluid secretion in Drosophila . Sci. Rep . 9 , 7464 ( 2019 ). OpenUrl CrossRef PubMed 51. ↵ K. A. Halberg , et al. , The cell adhesion molecule Fasciclin2 regulates brush border length and organization in Drosophila renal tubules . Nat. Commun . 7 , 11266 ( 2016 ). 52. ↵ S. Kondo , R. Ueda , Highly improved gene targeting by germline-specific Cas9 expression in Drosophila . Genetics 195 , 715 – 721 ( 2013 ). OpenUrl Abstract / FREE Full Text 53. ↵ S. Kondo , et al. , Neurochemical organization of the Drosophila brain visualized by endogenously tagged neurotransmitter receptors . Cell Rep . 30 , 284 – 297 .e5 ( 2020 ). OpenUrl CrossRef PubMed 54. ↵ N. Okamoto , et al. , A Membrane transporter is required for steroid hormone uptake in Drosophila . Dev. Cell 47 , 294 – 305 .e7 ( 2018 ). OpenUrl CrossRef PubMed 55. ↵ N. Okamoto et al. , Neuroendocrine control of calcium mobilization in the fruit fly . Nature , ( 2025 ). https://www.nature.com/articles/s41586-025-09670-z 56. G. Manoli , M. Zandawala , T. Yoshii , C. Helfrich-Förster , Characterization of clock-related proteins and neuropeptides in Drosophila littoralis and their putative role in diapause . J. Comp. Neurol . 531 , 1525 – 1549 ( 2023 ). OpenUrl CrossRef PubMed 57. ↵ K. Masuda , et al. , Microwave-assisted solid-phase peptide synthesis of neurosecretory protein GL composed of 80 amino acid residues . J. Pept. Sci . 21 , 454 – 460 ( 2015 ). OpenUrl CrossRef PubMed 58. ↵ H. Katayama , T. Ohira , K. Nagata , H. Nagasawa , A recombinant molt-inhibiting hormone of the kuruma prawn has a similar secondary structure to a native hormone: determination of disulfide bond arrangement and measurements of circular dichroism spectra . Biosci. Biotechnol. Biochem . 65 , 1832 – 1839 ( 2001 ). OpenUrl CrossRef PubMed Web of Science 59. ↵ B. N. Harwood , et al. , Membrane tethered bursicon constructs as heterodimeric modulators of the Drosophila G protein–coupled receptor rickets . Mol. Pharmacol . 83 , 814 – 821 ( 2013 ). OpenUrl Abstract / FREE Full Text 60. ↵ B. N. Harwood , I. Draper , A. S. Kopin , Targeted inactivation of the rickets receptor in muscle compromises Drosophila viability . J. Exp. Biol . 217 , jeb.110098 ( 2014 ). OpenUrl 61. ↵ J. H. Tupy , J. Machin , Transport characteristics of the isolated rectal complex of the mealworm Tenebrio molitor . Can. J. Zool . 63 , 1897 – 1903 ( 1985 ). OpenUrl 62. ↵ Y. Feng , A. Ueda , C.-F. Wu , A modified minimal hemolymph-like solution, HL3.1, for physiological recordings at the neuromuscular junctions of normal and mutant Drosophila larvae . J. Neurogenet. 18 , 377 – 402 ( 2004 ). OpenUrl CrossRef PubMed Web of Science View the discussion thread. Back to top Previous Next Posted October 25, 2025. Download PDF Supplementary Material Email Thank you for your interest in spreading the word about bioRxiv. NOTE: Your email address is requested solely to identify you as the sender of this article. Your Email * Your Name * Send To * Enter multiple addresses on separate lines or separate them with commas. You are going to email the following Ion transport peptide regulates body water balance via a receptor guanylyl cyclase in the Drosophila hindgut Message Subject (Your Name) has forwarded a page to you from bioRxiv Message Body (Your Name) thought you would like to see this page from the bioRxiv website. Your Personal Message CAPTCHA This question is for testing whether or not you are a human visitor and to prevent automated spam submissions. Share Ion transport peptide regulates body water balance via a receptor guanylyl cyclase in the Drosophila hindgut Akira Watanabe , Takashi Koyama , Olga Kubrak , Michael James Texada , Megumi Furumitsu , Eiko Iwakoshi-Ukena , Roilea Maxson , Taishi Yoshii , Shu Kondo , Naoki Yamanaka , Kazuyoshi Ukena , Kim Rewitz , Ryusuke Niwa , Naoki Okamoto bioRxiv 2025.10.24.684309; doi: https://doi.org/10.1101/2025.10.24.684309 Share This Article: Copy Citation Tools Ion transport peptide regulates body water balance via a receptor guanylyl cyclase in the Drosophila hindgut Akira Watanabe , Takashi Koyama , Olga Kubrak , Michael James Texada , Megumi Furumitsu , Eiko Iwakoshi-Ukena , Roilea Maxson , Taishi Yoshii , Shu Kondo , Naoki Yamanaka , Kazuyoshi Ukena , Kim Rewitz , Ryusuke Niwa , Naoki Okamoto bioRxiv 2025.10.24.684309; doi: https://doi.org/10.1101/2025.10.24.684309 Citation Manager Formats BibTeX Bookends EasyBib EndNote (tagged) EndNote 8 (xml) Medlars Mendeley Papers RefWorks Tagged Ref Manager RIS Zotero Tweet Widget Facebook Like Google Plus One Subject Area Physiology Subject Areas All Articles Animal Behavior and Cognition (7618) Biochemistry (17635) Bioengineering (13859) Bioinformatics (41846) Biophysics (21401) Cancer Biology (18534) Cell Biology (25423) Clinical Trials (138) Developmental Biology (13352) Ecology (19860) Epidemiology (2067) Evolutionary Biology (24286) Genetics (15582) Genomics (22463) Immunology (17700) Microbiology (40298) Molecular Biology (17141) Neuroscience (88429) Paleontology (666) Pathology (2825) Pharmacology and Toxicology (4813) Physiology (7633) Plant Biology (15107) Scientific Communication and Education (2042) Synthetic Biology (4284) Systems Biology (9808) Zoology (2267)

Text is read by the "Ask this paper" AI Q&A widget below. Extraction quality varies by source — PMC NXML preserves structure cleanly, OA-HTML may include some navigation residue, and OA-PDF can have broken hyphenation. The publisher copy (via DOI) is the canonical version.

My notes (saved in your browser only)

Ask this paper AI returns verbatim quotes from the full text · source: preprint-html

Answers must be backed by verbatim quotes from this paper's full text. Hallucinated quotes are dropped automatically; if no verbatim passage answers the question, we say so. How this works

Citation neighborhood (no data yet)

We don't have any in-corpus citations linked to this paper yet. This is a recent paper (2025) — citers typically take a year or two to land, and the OpenAlex reference graph may still be filling in.

Source provenance

europepmc
last seen: 2026-05-20T01:45:00.602351+00:00