Full text
82,864 characters
· extracted from
preprint-html
· click to expand
Reconstructing NOD-like receptor alleles with high internal conservation in Podospora anserina using long-read sequencing | bioRxiv /* */ /* */ <!-- <!-- /*! * yepnope1.5.4 * (c) WTFPL, GPLv2 */ (function(a,b,c){function d(a){return"[object Function]"==o.call(a)}function e(a){return"string"==typeof a}function f(){}function g(a){return!a||"loaded"==a||"complete"==a||"uninitialized"==a}function h(){var a=p.shift();q=1,a?a.t?m(function(){("c"==a.t?B.injectCss:B.injectJs)(a.s,0,a.a,a.x,a.e,1)},0):(a(),h()):q=0}function i(a,c,d,e,f,i,j){function k(b){if(!o&&g(l.readyState)&&(u.r=o=1,!q&&h(),l.onload=l.onreadystatechange=null,b)){"img"!=a&&m(function(){t.removeChild(l)},50);for(var d in y[c])y[c].hasOwnProperty(d)&&y[c][d].onload()}}var j=j||B.errorTimeout,l=b.createElement(a),o=0,r=0,u={t:d,s:c,e:f,a:i,x:j};1===y[c]&&(r=1,y[c]=[]),"object"==a?l.data=c:(l.src=c,l.type=a),l.width=l.height="0",l.onerror=l.onload=l.onreadystatechange=function(){k.call(this,r)},p.splice(e,0,u),"img"!=a&&(r||2===y[c]?(t.insertBefore(l,s?null:n),m(k,j)):y[c].push(l))}function j(a,b,c,d,f){return q=0,b=b||"j",e(a)?i("c"==b?v:u,a,b,this.i++,c,d,f):(p.splice(this.i++,0,a),1==p.length&&h()),this}function k(){var a=B;return a.loader={load:j,i:0},a}var l=b.documentElement,m=a.setTimeout,n=b.getElementsByTagName("script")[0],o={}.toString,p=[],q=0,r="MozAppearance"in l.style,s=r&&!!b.createRange().compareNode,t=s?l:n.parentNode,l=a.opera&&"[object Opera]"==o.call(a.opera),l=!!b.attachEvent&&!l,u=r?"object":l?"script":"img",v=l?"script":u,w=Array.isArray||function(a){return"[object Array]"==o.call(a)},x=[],y={},z={timeout:function(a,b){return b.length&&(a.timeout=b[0]),a}},A,B;B=function(a){function b(a){var a=a.split("!"),b=x.length,c=a.pop(),d=a.length,c={url:c,origUrl:c,prefixes:a},e,f,g;for(f=0;f<d;f++)g=a[f].split("="),(e=z[g.shift()])&&(c=e(c,g));for(f=0;f<b;f++)c=x[f](c);return c}function g(a,e,f,g,h){var i=b(a),j=i.autoCallback;i.url.split(".").pop().split("?").shift(),i.bypass||(e&&(e=d(e)?e:e[a]||e[g]||e[a.split("/").pop().split("?")[0]]),i.instead?i.instead(a,e,f,g,h):(y[i.url]?i.noexec=!0:y[i.url]=1,f.load(i.url,i.forceCSS||!i.forceJS&&"css"==i.url.split(".").pop().split("?").shift()?"c":c,i.noexec,i.attrs,i.timeout),(d(e)||d(j))&&f.load(function(){k(),e&&e(i.origUrl,h,g),j&&j(i.origUrl,h,g),y[i.url]=2})))}function h(a,b){function c(a,c){if(a){if(e(a))c||(j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}),g(a,j,b,0,h);else if(Object(a)===a)for(n in m=function(){var b=0,c;for(c in a)a.hasOwnProperty(c)&&b++;return b}(),a)a.hasOwnProperty(n)&&(!c&&!--m&&(d(j)?j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}:j[n]=function(a){return function(){var b=[].slice.call(arguments);a&&a.apply(this,b),l()}}(k[n])),g(a[n],j,b,n,h))}else!c&&l()}var h=!!a.test,i=a.load||a.both,j=a.callback||f,k=j,l=a.complete||f,m,n;c(h?a.yep:a.nope,!!i),i&&c(i)}var i,j,l=this.yepnope.loader;if(e(a))g(a,0,l,0);else if(w(a))for(i=0;i (function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0];var j=d.createElement(s);var dl=l!='dataLayer'?'&l='+l:'';j.src='//www.googletagmanager.com/gtm.js?id='+i+dl;j.type='text/javascript';j.async=true;f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-M677548'); Skip to main content Home About Submit ALERTS / RSS Search for this keyword Advanced Search New Results Reconstructing NOD-like receptor alleles with high internal conservation in Podospora anserina using long-read sequencing View ORCID Profile S. Lorena Ament-Velásquez , View ORCID Profile Brendan Furneaux , Sonia Dheur , View ORCID Profile Alexandra Granger-Farbos , View ORCID Profile Rike Stelkens , View ORCID Profile Hanna Johannesson , View ORCID Profile Sven J. Saupe doi: https://doi.org/10.1101/2025.01.13.632504 S. Lorena Ament-Velásquez 1 Department of Zoology, Stockholm University , 106 91 Stockholm, Sweden Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for S. Lorena Ament-Velásquez For correspondence: slament{at}protonmail.com Brendan Furneaux 2 Department of Biological and Environmental Science, University of Jyväskylä , Jyväskylä 40014, Finland Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Brendan Furneaux Sonia Dheur 3 IBGC UMR 5095 CNRS University of Bordeaux , 33077 Bordeaux, France Find this author on Google Scholar Find this author on PubMed Search for this author on this site Alexandra Granger-Farbos 3 IBGC UMR 5095 CNRS University of Bordeaux , 33077 Bordeaux, France Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Alexandra Granger-Farbos Rike Stelkens 1 Department of Zoology, Stockholm University , 106 91 Stockholm, Sweden Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Rike Stelkens Hanna Johannesson 4 Department of Ecology, Environmental and Plant Sciences, Stockholm University , 106 91 Stockholm, Sweden 5 Systematic Biology, Department of Organismal Biology, Uppsala University , Norbyvägen 18D, 752 36 Uppsala, Sweden 6 The Royal Swedish Academy of Sciences , 114 18 Stockholm, Sweden Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Hanna Johannesson Sven J. Saupe 3 IBGC UMR 5095 CNRS University of Bordeaux , 33077 Bordeaux, France Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Sven J. Saupe Abstract Full Text Info/History Metrics Supplementary material Data/Code Preview PDF Abstract NOD-like receptors (NLRs) are intracellular immune receptors that detect pathogen-associated cues and trigger defense mechanisms, including regulated cell death. In filamentous fungi, some NLRs mediate heterokaryon incompatibility, a self/non-self recognition process that prevents the vegetative fusion of genetically distinct individuals, reducing the risk of parasitism. The het-d and het-e NLRs in Podospora anserina are highly polymorphic incompatibility genes ( het genes) whose products recognize different alleles of the het-c gene via a sensor domain composed of WD40 repeats. These repeats display unusually high sequence identity maintained by concerted evolution. However, some sites within individual repeats are hypervariable and under diversifying selection. Despite extensive genetic studies, inconsistencies in the reported WD40 domain sequence have hindered functional and evolutionary analyses. Here we demonstrate that the WD40 domain can be accurately reconstructed from long-read sequencing (Oxford Nanopore and PacBio) data, but not from Illumina-based assemblies. Functional alleles are usually formed by 11 highly conserved repeats, with different repeat combinations underlying the same phenotypic het-d and het-e incompatibility reactions. Protein structure models suggest that their WD40 domain folds into two 7-blade β-propellers composed of the highly conserved repeats, as well as three cryptic divergent repeats at the C-terminus. We additionally show that one particular het-e allele does not have an incompatibility reaction with common het-c alleles, despite being 11-repeats long. Our findings provide a robust foundation for future research into the molecular mechanisms and evolutionary dynamics of het NLRs, while also highlighting both the fragility and the flexibility of β -propellers as immune sensor domains. Introduction NOD-like receptors (NLRs) are a class of almost universally conserved intracellular immune receptors that play crucial roles in animal, plant, fungal, and bacterial host defense systems ( Jones et al. 2016 ; Urbach and Ausubel 2017 ; Dyrka et al. 2014 ; Kibby et al. 2023 ). Sometimes referred to as cellular “guardians”, NLRs can sense cues of the unwanted invasion of nonself entities, such as pathogen-derived molecules or pathogen-induced modifications of host cells ( Duxbury et al. 2021 ). Typically, NLRs have a tripartite domain architecture and function through ligand-induced oligomerization ( Fu et al. 2024 ; Gao et al. 2022 ; Hu and Chai 2023 ). When a non-self ligand binds to the C-terminal domain (the “sensor”), which is composed of superstructure-forming repeats, it triggers the multimerization of the central nucleotide-binding and oligomerization domain (NBD). This change in the NBD, in turn, activates the N-terminal effector domain that usually leads to regulated cell death ( Maekawa et al. 2023 ). Given this general mode of action, the sensor domain can be under strong selective pressure to keep up with the evolution of pathogens, which change constantly to avoid detection ( Kibby et al. 2023 ; Allen et al. 2004 ; Melepat et al. 2024 ). Filamentous fungi possess large and diverse repertoires of NLRs ( Daskalov et al. 2020 ; Dyrka et al. 2014 ; Wojciechowski et al. 2022 ). However, only a few have been functionally characterized, all within the context of heterokaryon or vegetative incompatibility — a self/non-self recognition mechanism occurring between strains of the same species ( Daskalov 2023 ). Growth in filamentous fungi is accomplished by extending their cells or hyphae, by branching, and by fusing with other cells, leading to the possibility of fusing with other individuals ( Glass and Dementhon 2006 ; Harris 2006 ). This vegetative fusion with non-self poses a great risk, since it opens the door for intracellular parasites such as mycoviruses and selfish organelles, including nuclei ( Bastiaans et al. 2016 ; Debets et al. 2012 ; Debets and Griffiths 1998 ; Biella et al. 2002 ). As a form of defense, different individuals can fuse successfully only if they are compatible at a set of specific loci, termed heterokaryon incompatibility ( het ) genes, some of which are NLRs. Mirroring the innate immune response of other eukaryotes and bacteria, the het NLRs trigger regulated cell death of the fused incompatible hyphae, preventing the exchange of cytoplasm and hence parasites ( Gonçalves et al. 2017 ). In plate cultures, this phenomenon can be observed as a line of dead cells in the contact zone between two incompatible strains, called the “barrage” ( Esser 2016 ). In accordance with their self/non-self recognition function, het genes in general are highly polymorphic at the population level, displaying signatures of balancing selection ( Auxier et al. 2024 ; Milgroom et al. 2018 ; Wu et al. 1998 ). Among filamentous fungi, Podospora anserina has one of the best-studied repertoires of het genes ( Esser 2016 ; Pinan-Lucarré et al. 2007 ). Early classical genetics work on a collection of 16 strains collected in France determined the existence of nine het loci ( Bernet 1967 ; Rizet and Esser 1953 ), all of which have now been cloned (reviewed in Clavé et al. 2024 ). From these genes, het-r , het-d , and het-e are paralogs from the same NLR type, collectively known as HNWD genes based on their domain architecture ( Paoletti et al. 2007 ). Specifically, HNWD genes are characterized by having a TIR-related H ET effector domain at the N-terminus, an NBD of the N ACHT type, and a sensing domain formed by WD 40 repeats at the C-terminus ( Figure 1A ). WD40 domains in general form doughnut-like (toroidal) folds called β-propellers assembled from six to eight repeats ( Fülöp and Jones 1999 ). While many NLRs have WD40 domains, the HWND sensor domain is peculiar in several aspects. On the one hand, the individual WD40 repeats display high sequence identity, ranging from over 80% to 100% within each gene ( Saupe et al. 1995a ; Espagne et al. 2002 ; Paoletti et al. 2007 ). It is proposed that such level of high internal conservation (HIC) reflects concerted evolution of the repeats through unequal crossing-overs or other recombination events that cause high mutation rates ( Chevanne et al. 2010 ; Paoletti et al. 2007 ; Saupe 2000). This process can add or remove repeat units, leading to length polymorphism in natural populations. On the other hand, while being overall very similar, the individual repeats also show extensive variability at four specific codon positions under diversifying selection, which map to amino acid residues predicted at the interaction surface of the β-propeller ( Paoletti et al. 2007 ). Download figure Open in new tab Figure 1. Primer on the het-d and het-e genes. (A) The domain structure of an HNWD NLR. (B) Incompatibility interactions between the most common het-c alleles and those of het-e and het-d . Shaded squares indicate a vegetative incompatibility reaction, while white squares indicate compatibility, following Saupe et al. (1995b) . (C) A typical PCR result when amplifying the WD40 domain of an HNWD gene from genomic DNA, in this case het-e (1% agarose gel). Three strains with known het-e alleles are shown. NBD: nucleotide-binding domain. Previous research has shown that the number and sequence of WD40 repeats determine the allele specificity of a given HNWD paralog ( Chevanne et al. 2010 ; Daskalov et al. 2015 ; Espagne et al. 1997 ; Saupe et al. 1995a ). For example, the product of one specific het-r allele of 11 repeats (also known as het-R or just R ) recognizes one allele of the het-v locus, triggering the vegetative incompatibility reaction ( Chevanne et al. 2010 ). Other combinations and numbers of repeats are not reactive (known as r ). Meanwhile, the products of the het-d and het-e genes recognize the same target, the glycolipid transfer protein coded by the het-c gene ( Bernet 1967 ; Saupe et al. 1995b ). The het-c gene itself is polymorphic and its different (phenotypic) alleles can be defined by their interaction with het-d and het-e ( Bernet 1967 ). For instance, the C2 allele triggers an incompatibility reaction with a specific het-e allele ( E1 ) and also with one particular het-d allele ( D1 ), but not with other alleles ( Figure 1B ). In other words, the other het-d/e alleles do not recognize C2 as a ligand. To date, three alleles of het-e ( E1 , E2 , and E3 ) are known to recognize het-c , while null variants are collectively known as the e4 allele. Likewise, het-d has two known reactive alleles ( D1 and D2 ) and a non-reactive allele ( d3 ). (In the literature, the different het alleles might be referred to as het-E1 , het-E2 , etc., but here we use a simplified terminology for readability). Although the genetics of het-d and het-e are well understood, the precise characteristics of their sensor domain remain unclear, likely due to their repetitive nature and HIC properties. The original study that identified het-e sequenced the allele of the French strain A (here referred to as E1 A ) and reported 10 WD40 repeats ( Saupe et al. 1995a ). Later, Espagne et al. (2002) resequenced the same E1 A allele but found differences in multiple amino acids. They also sequenced the het-e allele of the strain C ( E2 C , 10 repeats) and used PCR and Southern blotting to estimate the number of repeats from several wildtype and mutant strains from the original French collection. On occasion, these two methods returned conflicting results, in which case they gave priority to the Southern blot analysis since PCR is susceptible to amplification artifacts ( Figure 1C ). Overall they concluded that at least 10 repeats are necessary for het-e to be reactive, that losing even a single repeat can break an allele, and that some alleles have the right size but are still non-reactive ( e4 ) ( Espagne et al. 2002 ; Saupe et al. 1995a ). More recently, Chevanne et al. (2010) resequenced E1 A yet again and found it to contain 11 repeats instead. In the case of het-d , only a single allele has been sequenced, D2 Y (from the French strain Y), consisting of 11 full repeats and the first 30 amino acids of a 12th repeat at the C-terminus ( Espagne et al. 2002 ). As for het-e , Espagne et al. (2002) examined the sizes of French wildtype het-d alleles by PCR and Southern blot, inferring that the functional D1 F also has 11 full repeats and a truncated one, while non-reactive alleles ( d3 ) have either less or more repeats. Thus, the actual sequences of most active alleles remain unknown, precluding additional functional and evolutionary studies. Moreover, the reported sizes of functional HNWD alleles (e.g., 10 or 11) are at odds with the number of repeats expected from usual β-propellers, which is six to eight repeats but most often seven ( Hu et al. 2017 ). The growing availability of genomic data has thrust the study of fungal NLRs into new frontiers ( Daskalov et al. 2015 ; Dyrka et al. 2014 ; Daskalov et al. 2020 ). However, modern whole genome sequencing using short-read (Illumina) technologies is not necessarily the solution for NLRs with HIC: tandem repeats with high sequence similarity can be notoriously difficult to assemble ( Tørresen et al. 2019 ). The length of a single WD40 repeat is 126 bp (42 amino acids), close to the size of a typical Illumina read, making it a borderline case. Long-read technologies, such as PacBio or Oxford Nanopore Technologies (ONT), hold the promise of accurate genome assembly, especially as error rates and costs decrease ( Sereika et al. 2022 ; Espinosa et al. 2024 ). Here we took advantage of published Illumina, PacBio, and ONT datasets of wildtype P. anserina strains ( Vogan et al. 2019 , 2021 ) to examine the HNWD alleles in the context of different sequencing technologies and assembly software. To resolve inconsistencies in the literature, we produced new ONT data to recover the reactive het-d and het-e alleles of the original French strains. Having established a reliable set of HNWD sequences, we assessed the interactions of a het-e allele seen in several wildtype strains. Finally, we discuss possible arrangements of their β-propeller domain using AlphaFold 3 protein structure models. Overall, we provide a basis for the study of the binding specificity and evolution of these variable immune receptors. Results The haplotypes of HNWD genes can be recovered consistently from long-read data but not from short-read assemblies To assess the consistency of HNWD genes across sequencing efforts we first focused on three P. anserina strains: the Dutch strain Wa63+ and the French strains Y+ and Z+ (the + and -annotation signify the mating type). These three strains are haploid and their genomes were originally sequenced as paired-end (125 bp x 2, insert size ∼350) libraries with Illumina HiSeq 2500 at high coverage (>70x) ( Vogan et al. 2019 ). In the same study, high-molecular-weight (HMW) DNA was also extracted from Wa63+ and Y+, which was then sequenced using either PacBio RSII or an R9 ONT flowcell, respectively ( Vogan et al. 2019 ). Here, we re-sequenced these same strains using R10 ONT flowcells in a barcoded library (see Methods). Hence, this dataset allowed us to compare the HNWD haplotypes obtained from different sequencing technologies and assemblies of the same strains at different time points ( Table 1 ). View this table: View inline View popup Table 1. Whole genome assemblies of P. anserina strains used in this study. We extracted the sequence of het-d , het-e, and het-r from each assembly and compared their WD40 domain ( Figure 2 ). To facilitate the visualization, we classified the HIC repeats of each gene by assigning an arbitrary number based on unique combinations of seven amino acids at positions previously inferred to be under diversifying selection ( Paoletti et al. 2007 ) ( Table S1 ). In addition, we calculated dissimilarity scores among the HIC repeat classes based on an amino acid physicochemical dissimilarity matrix ( Urbina et al. 2006 ). The scores were used to generate palettes in the CIE L*a*b* color space, such that similar colors imply similar physicochemical characteristics. We found that repeats were more different between paralogs than among the repeats of each paralog, so we assigned an independent palette per gene to facilitate contrast. See also Figures S1 , S2 , and S3 . Download figure Open in new tab Figure 2. Assembly of the WD40 domain from different sequencing technologies. Only repeats with high internal conservation are shown. Each repeat was arbitrarily classified based on unique amino acid combinations, but the colors reflect their physicochemical similarity (each gene has an independent palette) Repeats with a track of missing data (Ns) are colored black. Black lines linking the repeats symbolize the containing scaffold. We found that the long-read assemblies were in agreement, regardless of the technology and assembler. In the case of het-r , both Y+ and Wa63+ recovered the exact same sequence of repeats as reported for the reference R allele ( Chevanne et al. 2010 ). This suggests that 1) the sequence obtained from the long-reads (and the reference itself) is correct, and 2) the HNWD alleles did not mutate despite an unknown amount of vegetative growth and culture transfers that the strains have undergone in the lab since isolation. Most sequencing datasets of non-model fungal species are based on short-read data, implying that NLRs with HIC are usually assembled from Illumina reads. What is the likelihood that these assemblies are correct? As a proof of concept, we used the popular short-read assembler SPAdes ( Prjibelski et al. 2020 ) to test if we can obtain equivalent haplotypes from the published Illumina data of Wa63+, Y+, and Z+. SPAdes constructs assembly graphs using multiple k-mer sizes, which can be selected automatically by the program ( Prjibelski et al. 2020 ). In our case, the selected k-mer sizes were 21, 33, and 55 bp (“default” treatment). To promote contiguity in the assembly, we also produced assemblies using an additional larger k-mer of 77 bp (the “all kmers” treatment). As before, we extracted the WD40 domain of the HNWD genes but found that it is often fragmented into two scaffolds ( Figure 2 ). In cases where an HNWD gene was fully contained within a scaffold, the haplotypes harbored tracks of missing data (Ns) or presented a different sequence than their long-read data counterparts (e.g., het-e in the strain Z+). The only exceptions where long (>5 repeats) alleles were correctly recovered from Illumina assemblies were those of het-r in the “all k-mers” SPAdes assemblies ( Figure 2 ). Notably, some SPAdes assemblies included chimeric repeats that were not present in the wildtype long-read haplotypes (e.g., repeat variant 32 in the “all kmers” het-e sequence of the strain Y+). The Illumina reads of Wa63+, Y+, and Z+ are relatively short, of 125 bp. Current Illumina technologies usually have slightly longer reads of 150 bp. To assess if that difference was enough to recover the HNWD alleles, we used published data of the strain Wa137-( Vogan et al. 2021 ). The genome of this strain was sequenced with R9 ONT flowcells as for Y+, but its short-read library was sequenced with the HiSeq X machine (150 bp paired-end, insert size ∼ 250 bp) ( Table 1 ). For this read length, SPAdes defaults to all k-mers (21, 33, 55, and 77); hence we only evaluated the assembly with those parameters. As with the other strains, we found that the HNWD haplotypes recovered are shorter than the long-read assembly, omitting or creating repeats ( Figure 2 ). We conclude from these analyses that HIC repeats are not recovered confidently from Illumina assemblies. Different WD40 repeat combinations result in the same functional allele The molecular biology studies that first described het-d and het-e used lab strains constructed by backcrossing the alleles of French strains with known phenotypes into the genomic background of a reference strain (s, also referred to as “little s”) ( Espagne et al. 1997 , 2002 ; Chevanne et al. 2010 ; Saupe et al. 1995a ). We sequenced the genome of some of these backcrossed strains using ONT R10 as above. The backcrossed strains are designated by their reactive genotypes. For example, the strain CmEm-contains the het-c ( C2 M ) and het-e ( E2 M ) alleles of the French strain M, while having the non-reactive het-d allele ( d3 s ) of strain s. Likewise, the strain ChEhDa+ has the het-c ( C3 H ) and het-e ( E1 H ) alleles of the H strain and the het-d allele ( D1 A ) of the A strain. The exceptions are strains with a null het-c allele, here termed Co (CoEc+ and CoEf+). The genome assemblies of these backcrossed strains consist of mostly full chromosomes or chromosome arms ( Table S1 ). The het-e and het-d sequences from these new genomes add to the collection of reliable sequences for alleles of known reactivity. The ChEhDa+ and CaDa-strains have the same het-d allele as the A strain ( D1 A ), and the recovered sequences were identical, reinforcing the notion that long-read assemblies represent the real DNA sequence. The strain Z+ above belongs to the original collection of French strains with known phenotypes ( Bernet 1967 ). The strain S (“big S”) is also part of this collection and its genome is considered the reference for the species, although it predates long-read technologies ( Espagne et al. 2008 ). However, S has non-reactive het-d and het-e alleles that are relatively short (e.g., Figure 1C ), and hence more likely to be correctly assembled. In addition, the strain Y+ is known to harbor a D2 allele ( Espagne et al. 2002 ) and an E1 allele (L. Belcour, personal communication). Hence, current data allows preliminary comparisons of intra-allele variation ( Figure 3 ). Download figure Open in new tab Figure 3. Long-read assemblies of het-d ( A ) and het-e ( B ) WD40 domain from different wildtype strains. Only repeats with high internal conservation are shown, arbitrarily classified based on unique amino acid combinations but colored based on their physicochemical similarity (each gene has an independent palette). Repeats containing stop codons or frameshifts are colored black. The red arrow highlights the single repeat distinguishing the reactive D1 ChEhDa+ allele from the non-reactive d3 Z+ allele. The black arrow marks the repeat with a deletion in the T G + sequence that is likely a misassembly. Blue arrows point to inferred alleles based on sequence or the number of repeats. A specific allele of het-e was selected for phenotypic testing. The beginning of the first repeat is missing in the E1 A sequence (GenBank accession number FJ897789 ) but the missing amino acids happen to be perfectly conserved in all sequences and hence we inferred it to be identical to the first repeat of E1 Y . In agreement with previous reports, our long-read assemblies show that all the reactive het-d alleles have 11 repeats with HIC, while the reactive het-e alleles can be 10, 11, or 12 repeats long ( Figure 3 ). However, the precise order and identity of the repeats from the published D2 Y and E2 C alleles show strong differences with the ONT assemblies ( Figure S4 ). Likely, older methodologies had difficulties establishing the specific order of repeats, but the general inference that the het-d and het-e alleles with less than 10 repeats are non-reactive still holds ( Saupe et al. 1995a ; Espagne et al. 2002 ). Indeed, many of the non-reactive sequenced alleles are short ( Figure 3 ). Nonetheless, as pointed out previously ( Espagne et al. 2002 ; Saupe et al. 1995a ), having the right number of repeats is not enough to create a reactive allele. A clear example is given by the non-reactive het-d allele of strain Z ( d3 Z ), which is identical to the D1 A allele except for a single repeat at the 10th position (red arrow in Figure 3A ). This repeat differs from its functional counterpart by just four amino acids ( Table S2 ), and has a single amino acid difference with the repeat variant 11 at the same position in D2 Y . The fact that some positions are highly conserved across allele classes further suggests that these positions are key for functionality (e.g., the 4th to 6th positions of het-d and second position of het-e ). Interestingly, none of the sequences from the same allele class are identical (e.g., all the different E1 alleles), implying that although a single misplaced repeat can break an allele, there must be some flexibility at some repeat positions. For example, there is considerable intra-and inter-allele variation at the 5th and 6th repeat positions of het-e ( Figure 3B ). The E1 M allele (CmEm-) is particularly puzzling since it is quite different from the other E1 alleles at the fifth to ninth repeats. Nonetheless, some positions might be diagnostic of an allele class. For example, all the E1 alleles have the same repeat at the 3rd and 4th positions, as well as the same last repeat (regardless of the haplotype length), relative to the E2 and E3 alleles. Notably, the length polymorphism seems to be concentrated towards the last three repeats of the E alleles, with the E3 alleles being the best illustration. In this case, a single repeat (classified as variant 9 in Figure 3B ) is repeated in E3 Z relative to E3 F . Likewise, the E1 M allele has an extra variant 10 repeat compared to the other E1 alleles. Having established a reference panel of allele sequences, we looked at published long-read data of other wildtype strains ( Vogan et al. 2019 , 2021 ). While T G + and Wa137-were sequenced with ONT R9, the other strains were sequenced using the PacBio RSII technology ( Vogan et al. 2019 , 2021 ). From these strains, Wa100+ has the same het-d sequence as Z+, and hence has a d3 allele ( Figure 3A ). The het-d sequence of T G + is in fact very similar to that of D2 Y , with the notorious exception of a single base-pair deletion at the third repeat ( Figure 3A ) and a substitution in position 17 (not under diversifying selection) of two repeats. Inspection of the short-read mapping to the assembly of this strain suggests that the deletion is a misassembly within a small homopolymer track ( Figure S5 ), which is a more acute problem in R9 data than R10 or PacBio ( Sereika et al. 2022 ). On the other hand, the strain Wa87+ has two stop codons in its sixth repeat that are supported by read mapping ( Figure S6 ). Hence, this strain likely has a disrupted protein and can be tentatively assigned to a d3 allele-type. All strains with less or more than 11 repeats can also be considered d3 ( Espagne et al. 2002 ). In the case of het-e , three strains have sequences identical to those in the reference panel: both Wa46+ and Wa58-have an E3 allele, while Wa100+ has an E1 allele ( Figure 3B ). Based on the similarity to E1 M , the sequence of Wa87-might be E1 , although that requires testing. Sequences with less than 10 repeats can be assigned to the e4 allele. The het-e allele of Wa63+ does not recognize common het-c alleles Although this is a small sample of strains, we noticed that one particular het-e sequence appeared in three wildtype strains: T G +, Wa63+, and Wa137-( Figure 3B ). The origin of T G + is unclear, although it might correspond to the French T strain ( Vogan et al. 2019 ). The other two strains were both sampled in Wageningen, the Netherlands, but one in 1994 and the other in 2016. Hence, we wondered if this was an unidentified functional E allele. As these strains have C2 , C9 , and C2 alleles, respectively, then these het-e sequences could not correspond to E1 or E2 alleles, as that would create self-incompatibility. To assess its reactivity, we cloned the het-e allele of Wa63+ on a plasmid and introduced it by transformation into two different recipient strains with no reactive het-e or het-d alleles: one with a C1d3e4 genotype and another with a C2d3d4 genotype ( Figure 4 ). In this way, it is possible to assay incompatibility to the common het-c alleles ( C1 , C2 , C3, and C4 ). In total, 24 transformants were tested in barrage assays against testers carrying the common het-c alleles. We found that all transformants were compatible with all het-c testers. In a control experiment, using a cloned D1 allele introduced into a the C1d3e4 recipient, 15 out of 24 tested transformants produced a barrage reaction. We conclude from this experiment that the het-e allele from Wa63+ does not lead to incompatibility with the common het-c alleles. Either this allele is inactive in incompatibility or, alternatively, it could lead to incompatibility to rare het-c alleles that were not tested in this experiment (see Discussion). Notably, this allele lacks a repeat variant 9, which is present towards the end of all known functional alleles. Download figure Open in new tab Figure 4. The het-e allele from Wa63+ is compatible with the four common het-c alleles. Barrage assay of a C1 and C2 strains transformed with the het-e allele of Wa63+ cloned on plasmid and tested with the four common het-c alleles. The C2 recipient strain (upper plate) allows for testing against C1 , C3 , and C4 . The C1 recipient (bottom plate) allows for testing against C2 , C3 and C4 . The E1 and E2 alleles (on the upper left on the upper and bottom plates respectively) are used for positive controls for the barrage (incompatibility) reaction. Note the barrage formation between the E2 and C4 testers in the bottom plate. In the strain designation, the het-c , het-d and het-e genotypes are omitted for clarity when strains carry inactive alleles. The reactive HNWD alleles likely form a double β-propeller structure with cryptic repeats The WD40 β-propeller fold is formed by six to eight, but usually seven, units called “blades”, which arrange radially around a central tunnel ( Fülöp and Jones 1999 ). Each blade, in turn, is formed by four antiparallel β-sheets named a , b , c , and d . By convention, a WD40 repeat does not exactly correspond to a blade, but instead starts with a d β-sheet from the previous blade, followed by a , b , and c sheets of the focal blade ( Figure S7A ). To close the circle, the last blade is often constructed from one to three β-sheets of the last repeat (the C-terminus), complemented by remaining β-sheets from the N-terminus, a configuration known as the molecular “velcro” ( Neer and Smith 1996 ; Fülöp and Jones 1999 ). Our results confirm that the most common reactive HNWD alleles display 11 HIC repeats, which would represent an atypical blade number. We turned to AlphaFold 3 to model the WD40 β-propellers of het-e . In a first experiment, we input a single repeat (the second HIC repeat in the E2 C allele) and modeled different combinations of blade numbers, from 6 to 9-mers. The AlphaFold model quality and confidence scores (pTM and ipTM, where 1 represents the best prediction) were highest for 7-mers and 8-mers ( Figure S7A ). As an alternative approach, we created an artificial sequence of 6, 7, 8, and 9 tandem identical repeats ( Figure S7B ). In this case, the 7-repeat sequence yielded the highest pTM value (0.95), suggesting seven is a relevant size for the het-e β-propellers. Next, we modeled the HET-E1 WD40 domain on its own ( Figure 5 ) and within the HET-C2/HET-E1 A protein complex ( Figure S8 ). Although with relatively weak support scores (for WD40 domain only ipTM = 0.32 and pTM = 0.41; for full length ipTM=0.47 and pTM 0.59), the resulting multimer model is consistent with previous observations. The WD40 domain of HET-E1 is modeled as two independent 7-mer β-propellers ( Figure 5 ), with the HET-C2 protein located at the predicted interaction surface that contains the hypervariable sites under diversifying selection ( Paoletti et al. 2007 ) ( Figure S8 ). The known specificity-defining residues of HET-C are also located in the predicted interaction surface ( Bastiaans et al. 2014 ). Importantly, the second predicted propeller is made of four canonical highly conserved blades (8th to 11th) and three additional cryptic (divergent) blades located at the C-terminus of the protein, closed by a molecular velcro with a cryptic d β-sheet on the N-terminus ( Figure 5 and Figure S8 ). These modeling approaches suggest that active WD40 repeat domains have a mosaic structure with two propellers forming a clamp-like structure, one of which comprises a combination of four canonical and three cryptic repeats. Such a model provides a plausible explanation for the occurrence of an otherwise unusual number of repeats in active het-d/e alleles. Download figure Open in new tab Figure 5. Ribbon diagrams of the WD40-domain structure from the HET-E1 protein ( E1 H allele) produced by AlphaFold 3. The first 817 sites containing the HET and NACHT domains were removed for clarity. The first propeller is colored with a rainbow palette to illustrate the direction of the individual β-sheets. The cryptic d β-sheet in the N-terminus of the WD40 domain that forms the molecular velcro with the C-terminus is also highlighted (forest green). The second propeller is colored based on HIC (red) and cryptic (salmon) repeats. Individual blades are numbered with Latin (HIC) or Roman (cryptic) numerals. Discussion Evolutionary and functional research of immune system genes, including NLRs, often comes with technical and methodological challenges. For example, rapid evolution might limit phylogenetic reconstructions or ascertainment of homology ( Messier-Solek et al. 2010 ). Likewise, the presence of paralogs and association with transposable elements can result in fragmented genome assemblies at precisely the NLR locations ( Yuen et al. 2014 ; Tørresen et al. 2019 ). Thus, highly similar repeats at the C-terminal domain (i.e., HIC) can act as the final nail in the coffin for the assembly of certain NLRs. Here we show that current long-read technologies fully overcome that problem for the WD40 domain of HNWD genes, regardless of the software and the technology used. By sequencing the alleles used in classical genetic studies, we provide confidence to older inferences on the characteristics of reactive alleles, but highlight the potential inconsistencies of Illumina-derived assemblies in general. These high-confidence sequences, in turn, can be used to infer the phenotype of other strains, bypassing difficult and time-consuming lab experiments. Ultimately, having multiple alleles that display the same phenotype allowed us to showcase both the fragility and the flexibility of β-propellers as sensor domains, properties that might be advantageous for immune receptors. Classic experiments designed to inactivate het genes found that the HNWDs have much higher mutation rates than their binding partners, het-c and het-v ( Labarère 1973 ). Subsequent studies demonstrated that the HNWD genes are particularly susceptible to mutations at their sensor domain, altering or inactivating their recognition specificities by losses, gains, and shuffling of repeats ( Chevanne et al. 2010 ; Espagne et al. 2002 ; Bastiaans et al. 2014 ). This “repeat instability” led to the suspicion that HNWDs (and potentially all NLRs with HIC) might easily break during somatic growth, driven by unequal crossing-overs and interparalog recombinations ( Chevanne et al. 2010 ; Paoletti et al. 2007 ). Our results suggest that if this process occurs during vegetative propagation in the lab, it is too infrequent in the sequencing reads to influence the assembly graph. Detecting somatic repeat mutations may require extremely deep long-read sequencing efforts. Nonetheless, intra-thallus diversity in NLR repeats might still be subject to selection in nature, in particular if occasional variants happen to improve recognition of nonself. It has been suggested that fungal NLRs might have a general innate immune system function similar to that of plants and animals ( Uehling et al. 2017 ; Paoletti and Saupe 2009 ). Immune system genes often display high diversity maintained by balancing selection, which is also a characteristic necessary for genetic systems controlling conspecific self-nonself recognition (allorecognition) ( Aanen et al. 2008 ; Buckley and Dooley 2022 ). Heterokaryon incompatibility is a type of allorecognition, and NLRs might occasionally get co-opted as het genes in different fungal lineages ( Paoletti and Saupe 2009 ). From that perspective, the high mutational rate associated with HIC repeats might be advantageous for both the innate immune system and allorecognition functions. The fact that the Wa63+ het-e allele contains 11 HIC repeats, the usual size of a functional allele, and occurs in three different strains, sampled in different places and years, suggested that this might not be a random spontaneous mutant allele. However, our transformation essays demonstrated that this allele does not trigger an incompatibility reaction with the most common het-c alleles. That leaves us with three possibilities: 1) the allele is truly nonfunctional and its frequency is maintained by genetic drift; 2) the allele can only recognize some rare het-c alleles that were not tested here; or 3) the allele can recognize another ligand, such as a pathogen-derived molecule. Theoretically, an NLR het gene could simultaneously retain an ancestral immune function, further contributing to the maintenance of genetic diversity ( Aanen et al. 2008 ; Bastiaans et al. 2014 ). Population and ecological studies on Podospora NLRs might help clarify this point. Sequencing multiple versions of the same het alleles revealed a surprising diversity of repeat numbers and sequence combinations, implying that the mutational input can easily converge to the same phenotypes. The sequenced E1 and E3 alleles can either be 11 or 12 HIC-repeats long, while the one known E2 allele has 10 HIC repeats. AlphaFold 3-predicted models were consistent with the idea that the WD40 domain of HNWD genes folds into two β-propellers and revealed the presence of cryptic repeats at the C-terminus. As several length differences between het-e variants of the same phenotype occur at the end of the HIC region, perhaps the second β-propeller can potentially be formed by 6 to 8 blades (in combination with the cryptic repeats) and remain functional. In contrast with the flexibility observed in het-e , the three known functional alleles of het-d all have 11 HIC repeats, and a single repeat change in the second propeller completely inactivated the het-d allele of the strain Z. Likewise, the only known reactive allele of het-r has 11 HIC repeats ( Chevanne et al. 2010 ). One might speculate that the flexibility of het-e is related to the exact form of the cryptic repeats, which correspond to a region highly diverged between the HNWD paralogs. The presence of highly similar repeats in the WD40 sensor domain of HNWD genes might be peculiar but is not a unique case for WD40 proteins. A large-scale screening of proteins with WD40 domains (not just NLRs) across the Tree of Life revealed that HIC happens most often in fungal and bacterial genomes ( Hu et al. 2017 ). Moreover, NLRs with other types of superstructure-forming domains, such as ankyrin, tetratricopeptide, and HEAT repeats, are also known to have HIC in different fungal groups ( Dyrka et al. 2014 ; Daskalov et al. 2020 ). There is even a report of a leucine-rich repeat NLR with HIC in a sea urchin genome ( Hibino et al. 2006 ). In all these cases, the size of these repeat types is very similar to those of the WD40 repeats, between 24 and 42 amino acids ( Yoshimura and Hirano 2016 ; Gupta and Chahota 2024 ; Marold et al. 2015 ). Therefore, the challenges we faced with short-read assembly of HNWD alleles are likely to apply to other NLRs across various taxonomic groups. Conclusion Long-read technologies have been instrumental in the correct assembly of plant and animal NLRs since their development (e.g., Witek et al. 2016 ; Tørresen et al. 2018 ). However, the study of fungal NLRs is relatively new, and most genomic resources used in previous analyses have been Illumina-based ( Daskalov et al. 2020 ), simply because most non-model species lack high-quality assemblies. Certainly, many aspects of NLRs can be fully studied from Illumina data, such as domain composition, diversity, and phylogenetic relationships. However, functional molecular biology studies can only do so much without high-confidence sequences, as in the case of het-d and het-e . Despite the availability of short-read population genomics data, the allele frequencies of these HNWD genes remain unknown. Such a gap hinders the study of potential balancing selection forces acting on them ( Ament-Velásquez et al. 2022 ). The increased availability of long-read assemblies will not only address this limitation, but will simultaneously allow for the study of other aspects of their biology. For example, the genomic location of an NLR might influence its epigenetic modifications or mutation load ( Sutherland et al. 2024 ). Looking forward, comparative studies of HNWD genes across populations and species, coupled with functional assays, may uncover novel roles for these genes beyond heterokaryon incompatibility. Additionally, integrating structural predictions with mutational analyses can clarify how β-propeller architecture contributes to the specificity of these immune receptors. Materials and Methods Fungal material and culture conditions The strains used in this study were obtained from either the University of Bordeaux ( Saupe et al. 1995a ) or from the collection maintained in the Johannesson Lab at Stockholm University, which in turn came from the Laboratory of Genetics at Wageningen University ( van der Gaag et al. 2000 ; Vogan et al. 2019 ). Work with all strains was done using monokaryotic (haploid) isolates, including those corresponding to the sequenced monokaryons in Vogan et al. (2019 , 2021 ). Hence, strains are designated by their name and their mating type (e.g., Wa63+ is the Wageningen Collection strain 63 with a mating type +). Mycelia for DNA extraction was obtained from two sources: Petri dishes (strains Y+, Wa63+, and Z+) and liquid cultures (all the strains with introgressed het-c , het-d, and het-e alleles into the strain s background). The cultures on Petri dishes were done with HPM media ( Vogan et al. 2019 ) plates topped with cellophane disks cut from X50 Cellophane membrane 14x14 cm sheets (Fisher Scientific GTF AB, product code 11927535) and previously autoclaved in deionized water between filter paper disks (Cassago et al., 2002). Plates were incubated at 27°C under 70% humidity for a 12:12 light:dark cycle for two or three days (if left longer the mycelia ages and becomes harder to remove from the cellophane). Around 100 mg of mycelia were harvested by scraping the cellophane disk with a cell scraper (Sarstedt, Inc., 83.3951) and stored at -70°C. It has been reported that P. anserina cultures in Luria-Bertani broth (LB) do not undergo senescence and are appropriate to get abundant and healthy mycelia ( Benocci et al. 2018 ). We tested the use of both Luria-Bertani agar (LA) plates and LB cultures for mycelia harvesting. We found that the growth in LA or LB media significantly varies depending on the P. anserina strain. While strains S (used by Benocci et al.) and s thrive, some strains from the Wageningen collection exhibit poor growth. We also found that LA plates are not appropriate for the mid-term storage of strains. Hence, we used LB cultures just for the DNA extraction of the het -gene introgressed strains. Specifically, we used a modified LB recipe from Benocci et al. (2018) that contains 10 g/L Tryptone, 5 g/L Yeast extract, 5 g/L NaCl, and 0.02 g/L Thymine 99%, to which we added biotin and thiamin to a final concentration of 5 μg/L and 100 μg/L, respectively, and 1 mL/L of the trace element solution of van Diepeningen et al. (2008) . We cut pieces of agar with mycelium from PASM0.2 plates ( van Diepeningen et al. 2008 ) grown as for the HPM plates above, and used them as inocula for flasks containing 200 mL of modified LB. We incubated the flasks at 27°C and 120 RPM for five days ( Vogan et al. 2019 ). The resulting mycelia balls were recovered from the flask with sterilized tweezers and stored at -70°C before extraction. DNA extraction and sequencing Whole-genome DNA was extracted with the Zymo Quick-DNA Fungal/Bacterial Miniprep Kit D6005 (Zymo Research; https://zymoresearch.eu/ ) and quantified with a Qubit 2.0 Fluorometer (Invitrogen). For the strain CmEm-, ∼800mg of mycelia were used for high-molecular-weight DNA extraction using the QIAGEN Genomic-tip 100/G kit (Qiagen). ONT sequencing was performed in-house using a Native Barcoding Kit 24 V14 SQK-NBD114.24 and a MinION Mk1C machine following the standard protocol. In total, 12 strains were barcoded into two pools (pool1: CmEm-, CoEc+, CoEc-, Y+, Z+, and Wa63+ with barcodes 1 to 6, and pool2: CoEf+, ChEhDa+, ChEhDa-, CaDa-, CsDf+, and CsDf-with barcodes 7 to 12). Each pool was sequenced in two separate R10.4.1 flow cells (FLO-MIN114), aiming at loading around 10-20 fmols of library for optimal duplex output (while assuming a highly fragmented DNA extraction to the detriment of sample CmEm-). Both libraries included 1 μl of diluted DNA control sample (DNA CS), a 3.6 kb standard amplicon used to QC the library. We added 5 μl of Bovine Serum Albumin (Invitrogen UltraPure BSA 50 mg/ml, AM2616) to the flow cell priming mix as recommended. The four flow cells (first two for pool1 and last two for pool2) were run until about 50 pores remained active (for 41 to 54 hours), generating 10.09 Gb, 9.89 Gb, 9.19 Gb, and 9.06 Gb estimated bases, respectively. All runs had the following settings: pore scan frequency of 1.5 hrs, minimum read length of 200 bps, read splitting on, and active channel selection on. The strains CoEc-, ChEhDa-, and CsDf-yield identical results to their opposite mating type counterparts so they were not discussed further in this study. PCR Amplification of het-e in Figure 1 was done with the forward 5’-GCCCTTGTATTTGCACCGAC-3’ and reverse 5’-CGTCCTGAGTAACAGCCAAGAAC-3’ primers, using the following temperature regime: 95 °C for 1 min; 35 cycles at 95°C for 15 s, 64°C for 15 s, and 72°C for 30 s; and 72°C for 7 min. The PCR reaction contained 8 μl ddH20, 0.5 μl of each primer (10 μM), 1μl of sample DNA, and 10 μl of MyTaq Red Mix (Meridian Bioscience™) for a total volume of 20 μl. Basecalling During sequencing in the MinION Mk1C machine, we activated the “Fast model, 400 bps” for live basecalling with guppy v7.1.4 (embedded in MinKNOW v23.07.12). These reads were used only for preliminary coverage assessment per sample and automatic demultiplexing. The demultiplexed pod5 files were basecalled using Dorado v. 0.5.3 ( https://github.com/nanoporetech/dorado/ ) with the [email protected] model. The resulting BAM files were transformed into fastq files with the bam2fq program of SAMtools v. 1.19.2 ( Danecek et al. 2021 ). Reads corresponding to the DNA Control Sample (DNA CS) introduced during library preparation were removed using chopper v. 0.7.0 ( De Coster and Rademakers 2023 ). Genome assembly and sequence analyses For each sample, we removed reads that contained perfect matches to ONT native barcodes assigned to other samples (0.06% to 0.26% of the reads). We removed barcodes and performed minimum quality control with fastplong v. 0.2.2 ( Chen 2023 ) and parameters –trimming_extension 20 -l 50 -q 15 -d 0.1 (hereafter, cleaned ONT reads). The cleaned ONT reads of each sample were used as input for Flye v. 2.9.3 ( Kolmogorov et al. 2019 ), with parameters --nano-hq --iterations 2. The scaffolds were oriented to match the chromosomes of the reference genome Podan2 ( Espagne et al. 2008 ). We visually looked for major rearrangements by mapping all assemblies to Podan2 with the NUCmer program of MUMmer v. 3.23 ( Kurtz et al. 2004 ). The Integrative Genomics Viewer (IGV) browser was used for read-mapping visualization ( Thorvaldsdóttir et al. 2013 ). Median read length and depth of coverage of the ONT R10 datasets were estimated by mapping the cleaned reads to their respective assemblies using minimap2 v. 2.26 ( Li 2018 ) and feeding the produced BAM file to Cramino v. 0.14.1 ( De Coster and Rademakers 2023 ). Equivalent values for published long-read assemblies of Wa63+ and Y+ genomes were taken from Vogan et al. (2019) . The paired-end Illumina reads of the strains Wa63+, Y+, Z+, and Wa137-were retrieved from NCBI’s Sequence Read Archive (accession numbers SRX5458088, SRX5458091, SRX11405146, and SRX8537866) and assembled with SPAdes v. 4.0.0 ( Prjibelski et al. 2020 ) using the --careful parameter and either the default k-mers setting (Wa63-, Z+, and Y-) or the k-mers 21, 33, 55, and 77 (all strains). The Illumina reads were mapped back to each assembly using BWA v. 0.7.18 ( Li and Durbin 2009 ). The resulting BAM file was sorted with SAMtools v. 1.21 ( Danecek et al. 2011 ) and the duplicates were marked with Picard v. 3.3.0 ( http://broadinstitute.github.io/picard/ ) with a value of 100 (Wa63-and Y-) or 2500 (Wa137-) for the --OPTICAL_DUPLICATE_PIXEL_DISTANCE parameter. Finally, the deduplicated BAM file was given as input of Qualimap v. 2.2.2d to obtain the average depth of coverage per assembly. The nucleotide sequences of het-d , het-e , and het-r were extracted from each assembly using the script query2haplotype.py v. 2.22 available at https://github.com/SLAment/Genomics with parameters --haplo --extrabp 800 --minsize 400 --vicinity 15000 --identity 95 and the S+ allele as query. The sequences were manually aligned and given as input for a custom snakemake pipeline for WD40 repeat classification ( https://github.com/SLAment/FixingHetDE ). We employed a REGEX string to identify each repeat, defined as in Hu et al. (2017) , and used the amino acids 10, 11, 12, 14, 30, 32, and 39 for classification based on their high dN/dS ratios ( Paoletti et al. 2007 ). Pairwise physicochemical dissimilarities between the different repeat variants were calculated based on the same seven high dN/dS positions by summing the pairwise distances at each position, as given by the amino acid physicochemical dissimilarity matrix in ( Urbina et al. 2006 ). To generate color palettes for displaying the repeats, colors were chosen in the three–dimensional CIE L*a*b* color space ( CIE 2019 ) using a variant of non-metric multidimensional scaling (NMDS) which matches the relative physicochemical distances of the repeat variants as closely as possible to the to the relative perceptual distances of the colors, while constraining the output to colors which can be represented in the sRGB gamut. This palette generation algorithm was inspired by Gecos ( Kunzmann et al. 2020 ), and was implemented as a custom R script (available at https://github.com/SLAment/FixingHetDE ) using the Python source for Gecos ( https://github.com/biotite-dev/gecos ) as reference. Cloning and transformation of het-e The het-e Wa63+ gene was PCR-amplified with oligonucleotides osd192 (CAAGGTTGTGGCGGTTTCAG) and osd193 (GCGTTTGACAAGACGGTGAC) (respectively positioned at 605 nt upstream and 459 nt downstream of the ORF) on 33 ng of genomic DNA extracted from the Wa63+ strain using the Q5 ® High-Fidelity 2X Master Mix (New England Biolabs, M0492S). We cloned 50 ng of PCR product in a pCR-Blunt II-TOPO ® vector using a Zero Blunt TOPO ® PCR Cloning Kit (Invitrogene, 45-0245) according to the manufacturer protocol. The ligation reaction was diluted at 1:4 in water and chemically NEB ® 5-alpha Competent E. coli (New England Biolabs, C2987H) were transformed with a twelfth of the ligation reaction. DNA transformation was performed as previously described ( Bergès and Barreau 1989 ) using the p1 vector, a pBlueScript-II derived vector containing the nat1 nourseothricin acethyl transferase gene in co-transformation and using a 5 ug of the het-e -bearing plasmid and 1 μg of the p1 co-transformation vector. The recipient strains for transformation were C2d3e4 ( het-c2 het-d3 het-e4 ) and C1d3d4 ( het-c1 het-d3 het-e4 ). Five days after transformation, 24 individual transformants in each transformation were tested in barrage assays against the four common het-c -alleles on corn meal agar. Prediction of protein structure We used the server of AlphaFold 3 ( Abramson et al. 2024 ) available at https://alphafoldserver.com/ to model the protein structure of the WD40 domain. We used the protein sequence of the second HIC repeat in the E2 C allele (TGTQTLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIWDAASG) as an arbitrary representative of a typical het-e HIC repeat. We gave this repeat to AlphaFold in 6, 7, 8, and 9 copies (multimers) to assess their predicted structure with default parameters. In addition, we input the protein sequence of HET-C2 (GenBank accession number AAA20542.1) and HET-E1 A (FJ897789; Figure S5 ) or HET-E1 H ( Figure 5 ), also with default parameters. Only the first predicted model (number 0) was considered. We visualized protein structures in USCF ChimeraX v1.8 ( Meng et al. 2023 ). Data availability The snakemake pipeline used for WD40 repeat classification, as well as the all the nucleotide sequences of the het genes (aligned and in fasta format) are available at https://github.com/SLAment/FixingHetDE . All genome assemblies generated in this study have been submitted to the Dryad Digital Repository ( https://doi.org/10.5061/dryad.h18931zww ). Declaration of generative AI and AI-assisted technologies in the writing process During the preparation of this work, the authors used ChatGPT to improve the flow and grammar of some parts of the manuscript. After using this tool, the authors reviewed and edited the content as needed and take full responsibility for the content of the published article. Supplementary Figures Download figure Open in new tab Figure S1. Heatmap of dissimilarity between the classes of HIC WD40 repeats of the het-d gene, based on seven amino acids. Download figure Open in new tab Figure S2. Heatmap of dissimilarity between the classes of HIC WD40 repeats of the het-e gene, based on seven amino acids. Download figure Open in new tab Figure S3. Heatmap of dissimilarity between the classes of HIC WD40 repeats of the het-r gene, based on seven amino acids. Download figure Open in new tab Figure S4. Comparison between the published alleles D2 Y ( A ) and E2 C ( B ) and corresponding long-read assemblies. The E2 C*4 allele is a mutant of the original E2 C allele as reconstructed in the original study of Espagne et al. (2002) . Download figure Open in new tab Figure S5. Short-and long-read mapping of the strain TG+ displayed in the Integrative Genomics Viewer (IGV) browser. Purple marks signal indels. Although not apparent in the long reads, the short-read mapping is consistent with a missing G (marked with a red arrow) at the end of the third repeat in the WD40 domain of het-d . White reads have multiple mappings. Blue reads signal smaller than expected insert size given the distribution of the paired-end reads. Download figure Open in new tab Figure S6. Short-and long-read mapping of the strain Wa87+ displayed in the Integrative Genomics Viewer (IGV) browser. Purple marks signal indels. The two stop codons found in the 6th repeat of the WD40 domain of het-d are marked with red arrows. Download figure Open in new tab Figure S7. Ribbon diagrams of the β-propellers produced by AlphaFold 3 when different iterations of a HET-E2 repeat (second HIC repeat in the E2 C allele) are given. In ( A ) the individual repeat is input as multiple molecules to form a protein complex, while in ( B ) an artificial sequence with a given number of identical repeats folds into a single structure. The pLDDT score has a 0-100 scale where a higher value indicates higher confidence. The predicted template modeling (pTM) score and the interface predicted template modeling (ipTM) score have a scale from 0 to 1 and measure the accuracy of the entire structure (a score of 1 is best). The ipTM score in particular measures the accuracy of the relative positions of the subunits in the protein complex (in this case the blade monomers). An individual blade is formed by a d β-sheet from one repeat and the a , b , and c β-sheets of the next repeat, as highlighted in the first diagram of ( A ). Download figure Open in new tab Figure S8. Ribbon diagrams of the WD40 domain of HET-E1 A interacting with HET-C2 as produced by AlphaFold 3. ( A ) The WD40 domain folds into two β-propellers with HET-C2 clamped in between. The first propeller is neatly assembled from seven HIC repeats ( B ), while the second propeller is produced from the remaining four HIC repeats, as well as three cryptic repeats (in Roman numerals) formed by the C-terminus of the protein and a d β-sheet on the N-terminus ( C ). The sites known to determine allele specificity are highlighted in HET-C2 with a stick representation (green). Acknowledgments We thank María de la Paz Celorio Mancera, Anbar Khodabandeh, Jennifer Molinet, and Javier Pinto for their assistance and support in the laboratory, as well as Kalle Tunström for advice with ONT sequencing. This work was supported by the Swedish Research Council (grant 2022-00341) and the Stiftelsen Anna-Greta och Holger Crafoords fond (CR2023-0039) to S.L.A.-V. The computations were performed on resources provided by NAISS at Uppsala Multidisciplinary Center for Advanced Computational Science (UPPMAX) partially funded by the Swedish Research Council through grant agreements no. 2022-06725 and no. 2018-05973, under projects NAISS 2024/23-530 and NAISS 2023/22-924. Molecular graphics and analyses performed with UCSF ChimeraX, developed by the Resource for Biocomputing, Visualization, and Informatics at the University of California, San Francisco, with support from National Institutes of Health R01-GM129325 and the Office of Cyber Infrastructure and Computational Biology, National Institute of Allergy and Infectious Diseases. Footnotes https://github.com/SLAment/FixingHetDE References 1. ↵ Aanen DK , Debets AJM , De Visser JAGM , Hoekstra RF. 2008 . The social evolution of somatic fusion . BioEssays 30 : 1193 – 1203 . OpenUrl CrossRef PubMed Web of Science 2. ↵ Abramson J , Adler J , Dunger J , Evans R , Green T , Pritzel A , Ronneberger O , Willmore L , Ballard AJ , Bambrick J , et al. 2024 . Accurate structure prediction of biomolecular interactions with AlphaFold 3 . Nature 630 : 493 – 500 . OpenUrl CrossRef PubMed 3. ↵ Allen RL , Bittner-Eddy PD , Grenville-Briggs LJ , Meitz JC , Rehmany AP , Rose LE , Beynon JL . 2004 . Host-Parasite Coevolutionary Conflict Between Arabidopsis and Downy Mildew . Science 306 : 1957 – 1960 . OpenUrl Abstract / FREE Full Text 4. ↵ Ament-Velásquez SL , Vogan AA , Granger-Farbos A , Bastiaans E , Martinossi-Allibert I , Saupe SJ , de Groot S , Lascoux M , Debets AJM , Clavé C , et al. 2022 . Allorecognition genes drive reproductive isolation in Podospora anserina . Nat Ecol Evol 6 : 910 – 923 . OpenUrl CrossRef PubMed 5. Ament-Velásquez SL , Vogan AA , Wallerman O , Hartmann FE , Gautier V , Silar P , Giraud T , Johannesson H. 2024 . High-Quality Genome Assemblies of 4 Members of the Podospora anserina Species Complex ed. L.-J. Ma . Genome Biology and Evolution 16 : evae034 . OpenUrl CrossRef PubMed 6. ↵ Auxier B , Zhang J , Marquez FR , Senden K , Van Den Heuvel J , Aanen DK , Snelders E , Debets AJM. 2024 . The Narrow Footprint of Ancient Balancing Selection Revealed by Heterokaryon Incompatibility Genes in Aspergillus fumigatus ed. H. Malik . Molecular Biology and Evolution 41 : msae079 . OpenUrl CrossRef PubMed 7. ↵ Bastiaans E , Debets AJM , Aanen DK . 2016 . Experimental evolution reveals that high relatedness protects multicellular cooperation from cheaters . Nature Communications 7 : 11435 . OpenUrl CrossRef PubMed 8. ↵ Bastiaans E , Debets AJM , Aanen DK , Van Diepeningen AD , Saupe SJ , Paoletti M. 2014 . Natural variation of heterokaryon incompatibility gene het-c in Podospora anserina reveals diversifying selection . Molecular Biology and Evolution 31 : 962 – 974 . OpenUrl CrossRef PubMed Web of Science 9. ↵ Benocci T , De Vries RP , Daly P. 2018 . A senescence-delaying pre-culture medium for transcriptomics of Podospora anserina . Journal of Microbiological Methods 146 : 33 – 36 . OpenUrl CrossRef PubMed 10. ↵ Bergès T , Barreau C . 1989 . Heat Shock at an Elevated Temperature Improves Transformation Efficiency of Protoplasts from Podospora anserina . Microbiology 135 : 601 – 604 . OpenUrl CrossRef PubMed 11. ↵ Bernet J . 1967 . Les systèmes d’incompatibilité chez le Podospora anserina . Comptes rendus hebdomadaires des séances de l’Académie des sciences, Série D 265 : 1330 – 1333 . OpenUrl 12. ↵ Biella S , Myron LS , Aist JR , Cortesi P , Milgroom MG . 2002 . Programmed cell death correlates with virus transmission in a filamentous fungus . Proceedings of the Royal Society of London B Biological Sciences 269 : 2269 – 2276 . OpenUrl CrossRef PubMed Web of Science 13. Boucher C , Nguyen T-S , Silar P . 2017 . Species Delimitation in the Podospora anserina/P. pauciseta/P. comata Species Complex (Sordariales). Cryptogamie , Mycologie 38 : 485 – 506 . OpenUrl 14. ↵ Buckley KM , Dooley H . 2022 . Immunological Diversity Is a Cornerstone of Organismal Defense and Allorecognition across Metazoa . The Journal of Immunology 208 : 203 – 211 . OpenUrl CrossRef PubMed 15. ↵ Chen S. 2023 . Ultrafast one-pass FASTQ data preprocessing, quality control, and deduplication using fastp . iMeta 2 : e107 . OpenUrl CrossRef 16. ↵ Chevanne D , Saupe SJ , Clavé C , Paoletti M . 2010 . WD-repeat instability and diversification of the Podospora anserina hnwd non-self recognition gene family . BMC Evolutionary Biology 10 . 17. ↵ CIE . 2019 . ISO/CIE 11664-4. Colorimetry – Part 4: CIE 1976 L*a*b* colour space . https://www.iso.org/standard/74166.html . 18. ↵ Clavé C , Dheur S , Ament-Velásquez SL , Granger-Farbos A , Saupe SJ. 2024 . het-B allorecognition in Podospora anserina is determined by pseudo-allelic interaction of genes encoding a HET and lectin fold domain protein and a PII-like protein ed. J. Heitman . PLoS Genet 20 : e1011114 . OpenUrl CrossRef PubMed 19. ↵ Danecek P , Auton A , Abecasis G , Albers CA , Banks E , DePristo MA , Handsaker RE , Lunter G , Marth GT , Sherry ST , et al. 2011 . The variant call format and VCFtools . Bioinformatics 27 : 2156 – 2158 . OpenUrl CrossRef PubMed Web of Science 20. ↵ Danecek P , Bonfield JK , Liddle J , Marshall J , Ohan V , Pollard MO , Whitwham A , Keane T , McCarthy SA , Davies RM , et al. 2021 . Twelve years of SAMtools and BCFtools . GigaScience 10 : giab008 . OpenUrl CrossRef PubMed 21. ↵ Daskalov A . 2023 . Emergence of the fungal immune system . iScience 26 : 106793 . OpenUrl CrossRef PubMed 22. ↵ J.P. Benz and K. Schipper Daskalov A , Dyrka W , Saupe SJ. 2020 . NLR Function in Fungi as Revealed by the Study of Self/Non-self Recognition Systems . In Genetics and Biotechnology (eds. J.P. Benz and K. Schipper ), pp. 123 – 141 , Springer International Publishing , Cham https://link.springer.com/10.1007/978-3-030-49924-2_6 (Accessed September 24, 2024). 23. ↵ Daskalov A , Habenstein B , Martinez D , Debets AJM , Sabaté R , Loquet A , Saupe SJ . 2015 . Signal Transduction by a Fungal NOD-Like Receptor Based on Propagation of a Prion Amyloid Fold . PLoS Biology 13 : 1 – 26 . OpenUrl CrossRef PubMed 24. ↵ De Coster W , Rademakers R . 2023 . NanoPack2: population-scale evaluation of long-read sequencing data ed. C. Alkan . Bioinformatics 39 : btad311 . OpenUrl CrossRef PubMed 25. ↵ Debets AJM , Dalstra HJP , Slakhorst M , Koopmanschap B , Hoekstra RF , Saupe SJ . 2012 . High natural prevalence of a fungal prion . Proceedings of the National Academy of Sciences of the United States of America 109 : 10432 – 10437 . OpenUrl Abstract / FREE Full Text 26. ↵ Debets AJM , Griffiths AJF . 1998 . Polymorphism of het-genes prevents resource plundering in Neurospora crassa . Mycological Research 102 : 1343 – 1349 . OpenUrl CrossRef 27. ↵ Duxbury Z , Wu C , Ding P . 2021 . A Comparative Overview of the Intracellular Guardians of Plants and Animals: NLRs in Innate Immunity and Beyond . Annu Rev Plant Biol 72 : 155 – 184 . OpenUrl CrossRef PubMed 28. ↵ Dyrka W , Lamacchia M , Durrens P , Kobe B , Daskalov A , Paoletti M , Sherman DJ , Saupe SJ . 2014 . Diversity and variability of NOD-like receptors in fungi . Genome Biology and Evolution 6 : 3137 – 3158 . OpenUrl CrossRef PubMed 29. ↵ Espagne E , Baldhadère P , Bégueret J , Turcq B . 1997 . Reactivity in vegetative incompatibility of the HET-E protein of the fungus Podospora anserina is dependent on GTP-binding activity and a WD40 repeated domain . Molecular & General Genetics 256 : 620 – 627 . OpenUrl CrossRef PubMed 30. ↵ Espagne E , Balhadère P , Penin ML , Barreau C , Turcq B . 2002 . HET-E and HET-D belong to a new subfamily of WD40 proteins involved in vegetative incompatibility specificity in the fungus Podospora anserina . Genetics 161 : 71 – 81 . OpenUrl Abstract / FREE Full Text 31. ↵ Espagne E , Lespinet O , Malagnac F , Da Silva C , Jaillon O , Porcel BM , Couloux A , Aury J-M , Ségurens B , Poulain J , et al. 2008 . The genome sequence of the model ascomycete fungus Podospora anserina . Genome Biology 9 : R77 . OpenUrl CrossRef PubMed 32. ↵ Espinosa E , Bautista R , Larrosa R , Plata O . 2024 . Advancements in long-read genome sequencing technologies and algorithms . Genomics 116 : 110842 . OpenUrl CrossRef PubMed 33. ↵ J. Wendland Esser K. 2016 . Heterogenic Incompatibility in Fungi . In Growth, Differentiation and Sexuality. The Mycota I (ed. J. Wendland ), Vol. 1 of, pp. 103 – 131 , Springer International Publishing , Switzerland http://link.springer.com/10.1007/978-3-319-25844-7_6 . OpenUrl CrossRef 34. ↵ Fu J , Schroder K , Wu H . 2024 . Mechanistic insights from inflammasome structures . Nat Rev Immunol 24 : 518 – 535 . OpenUrl CrossRef PubMed 35. ↵ Fülöp V , Jones DT . 1999 . β Propellers: structural rigidity and functional diversity . Current Opinion in Structural Biology 9 : 715 – 721 . OpenUrl CrossRef PubMed Web of Science 36. ↵ Gao LA , Wilkinson ME , Strecker J , Makarova KS , Macrae RK , Koonin EV , Zhang F . 2022 . Prokaryotic innate immunity through pattern recognition of conserved viral proteins . Science 377 : eabm4096 . OpenUrl CrossRef PubMed 37. ↵ Glass NL , Dementhon K . 2006 . Non-self recognition and programmed cell death in filamentous fungi . Current Opinion in Microbiology 9 : 553 – 558 . OpenUrl CrossRef PubMed 38. ↵ Gonçalves AP , Heller J , Daskalov A , Videira A , Glass NL . 2017 . Regulated Forms of Cell Death in Fungi . Front Microbiol 8 : 1837 . OpenUrl CrossRef PubMed 39. ↵ Gupta T , Chahota R . 2024 . Unique ankyrin repeat proteins in the genome of poxviruses-Boon or Wane, a critical review . Gene 927 : 148759 . OpenUrl CrossRef PubMed 40. ↵ Harris SD . 2006 . Cell Polarity in Filamentous Fungi: Shaping the Mold . International Review of Cytology 251 : 41 – 77 . OpenUrl CrossRef PubMed Web of Science 41. ↵ Hibino T , Loza-Coll M , Messier C , Majeske AJ , Cohen AH , Terwilliger DP , Buckley KM , Brockton V , Nair SV , Berney K , et al. 2006 . The immune gene repertoire encoded in the purple sea urchin genome . Developmental Biology 300 : 349 – 365 . OpenUrl CrossRef PubMed Web of Science 42. ↵ Hu X-J , Li T , Wang Y , Xiong Y , Wu X-H , Zhang D-L , Ye Z-Q , Wu Y-D . 2017 . Prokaryotic and Highly-Repetitive WD40 Proteins: A Systematic Study . Sci Rep 7 : 10585 . OpenUrl CrossRef PubMed 43. ↵ Hu Z , Chai J . 2023 . Assembly and Architecture of NLR Resistosomes and Inflammasomes . Annu Rev Biophys 52 : 207 – 228 . OpenUrl CrossRef PubMed 44. ↵ Jones JDG , Vance RE , Dangl JL . 2016 . Intracellular innate immune surveillance devices in plants and animals . Science 354 . 45. ↵ Kibby EM , Conte AN , Burroughs AM , Nagy TA , Vargas JA , Whalen LA , Aravind L , Whiteley AT . 2023 . Bacterial NLR-related proteins protect against phage . Cell 186 : 2410 – 2424 .e18. OpenUrl CrossRef PubMed 46. ↵ Kolmogorov M , Yuan J , Lin Y , Pevzner PA . 2019 . Assembly of long, error-prone reads using repeat graphs . Nat Biotechnol 37 : 540 – 546 . OpenUrl CrossRef PubMed 47. ↵ Kunzmann P , Mayer BE , Hamacher K . 2020 . Substitution matrix based color schemes for sequence alignment visualization . BMC Bioinformatics 21 : 209 . OpenUrl CrossRef PubMed 48. ↵ Kurtz S , Phillippy A , Delcher AL , Smoot M , Shumway M , Antonescu C , Salzberg SL . 2004 . Versatile and open software for comparing large genomes . Genome biology 5 : R12 . OpenUrl CrossRef PubMed 49. ↵ Labarère J . 1973 . Propriétes d’un système d’incompatibilité chez le champignon Podospora anserina et intérêt de ce système pour l’étude de l’incompatibilté . Comptes rendus de l’Académie des Sciences 276 : 1301 – 1304 . OpenUrl 50. ↵ Li H. 2018 . Minimap2: pairwise alignment for nucleotide sequences ed. I. Birol . Bioinformatics 34 : 3094 – 3100 . OpenUrl CrossRef PubMed 51. ↵ Li H , Durbin R . 2009 . Fast and accurate short read alignment with Burrows-Wheeler transform. Bioinformatics (Oxford , England ) 25 : 1754 – 60 . OpenUrl 52. ↵ Maekawa T , Kashkar H , Coll NS . 2023 . Dying in self-defence: a comparative overview of immunogenic cell death signalling in animals and plants . Cell Death Differ 30 : 258 – 268 . OpenUrl CrossRef PubMed 53. ↵ Marold JD , Kavran JM , Bowman GD , Barrick D . 2015 . A Naturally Occurring Repeat Protein with High Internal Sequence Identity Defines a New Class of TPR-like Proteins . Structure 23 : 2055 – 2065 . OpenUrl CrossRef 54. ↵ Melepat B , Li T , Vinkler M . 2024 . Natural selection directing molecular evolution in vertebrate viral sensors . Developmental & Comparative Immunology 154 : 105147 . OpenUrl CrossRef PubMed 55. ↵ Meng EC , Goddard TD , Pettersen EF , Couch GS , Pearson ZJ , Morris JH , Ferrin TE . 2023 . UCSF ChimeraX: Tools for structure building and analysis . Protein Science 32 : e4792 . OpenUrl CrossRef PubMed 56. ↵ Messier-Solek C , Buckley KM , Rast JP . 2010 . Highly diversified innate receptor systems and new forms of animal immunity . Seminars in Immunology 22 : 39 – 47 . OpenUrl CrossRef PubMed Web of Science 57. ↵ Milgroom MG , Smith ML , Drott MT , Nuss DL . 2018 . Balancing selection at nonself recognition loci in the chestnut blight fungus, Cryphonectria parasitica, demonstrated by trans- species polymorphisms, positive selection, and even allele frequencies . Heredity 121 : 511 – 523 . OpenUrl CrossRef PubMed 58. ↵ Neer EJ , Smith TF . 1996 . G Protein Heterodimers: New Structures Propel New Questions . Cell 84 : 175 – 178 . OpenUrl CrossRef PubMed Web of Science 59. ↵ Paoletti M , Saupe SJ . 2009 . Fungal incompatibility: Evolutionary origin in pathogen defense? BioEssays 31 : 1201 – 1210 . OpenUrl CrossRef PubMed Web of Science 60. ↵ Paoletti M , Saupe SJ , Clavé C. 2007 . Genesis of a Fungal Non-Self Recognition Repertoire ed. J. Fraser . PLoS ONE 2 : e283 . OpenUrl CrossRef PubMed 61. ↵ Pinan-Lucarré B , Paoletti M , Clavé C . 2007 . Cell death by incompatibility in the fungus Podospora . Seminars in Cancer Biology 17 : 101 – 111 . OpenUrl CrossRef PubMed Web of Science 62. ↵ Prjibelski A , Antipov D , Meleshko D , Lapidus A , Korobeynikov A . 2020 . Using SPAdes De Novo Assembler . CP in Bioinformatics 70 : e102 . OpenUrl CrossRef 63. ↵ Rizet G , Esser K . 1953 . Sur les phénomènes d’incompatibilité entre souches d’origine géographique différente chez le Podospora anserina . CR Acad Sci 237 : 760 – 762 . OpenUrl 64. ↵ Saupe S , Turcq B , Bégueret J . 1995a . A gene responsible for vegetative incompatibility in the fungus Podospora anserina encodes a protein with a GTP-binding motif and Gβ homologous domain . Gene 162 : 135 – 139 . OpenUrl CrossRef PubMed Web of Science 65. ↵ Saupe S , Turcq B , Bégueret J . 1995b . Sequence diversity and unusual variability at the het-c locus involved in vegetative incompatibility in the fungus Podospora anserina . Curr Genet 27 : 466 – 471 . OpenUrl CrossRef PubMed Web of Science 66. ↵ Sereika M , Kirkegaard RH , Karst SM , Michaelsen TY , Sørensen EA , Wollenberg RD , Albertsen M . 2022 . Oxford Nanopore R10.4 long-read sequencing enables the generation of near- finished bacterial genomes from pure cultures and metagenomes without short-read or reference polishing . Nat Methods 19 : 823 – 826 . OpenUrl CrossRef PubMed 67. ↵ Sutherland CA , Prigozhin DM , Monroe JG , Krasileva KV . 2024 . High allelic diversity in Arabidopsis NLRs is associated with distinct genomic features . EMBO Rep 25 : 2306 – 2322 . OpenUrl CrossRef PubMed 68. ↵ Thorvaldsdóttir H , Robinson JT , Mesirov JP . 2013 . Integrative Genomics Viewer (IGV): high- performance genomics data visualization and exploration . Briefings in Bioinformatics 14 : 178 – 192 . OpenUrl CrossRef PubMed 69. ↵ Tørresen OK , Brieuc MSO , Solbakken MH , Sørhus E , Nederbragt AJ , Jakobsen KS , Meier S , Edvardsen RB , Jentoft S . 2018 . Genomic architecture of haddock (Melanogrammus aeglefinus) shows expansions of innate immune genes and short tandem repeats . BMC Genomics 19 : 240 . OpenUrl CrossRef PubMed 70. ↵ Tørresen OK , Star B , Mier P , Andrade-Navarro MA , Bateman A , Jarnot P , Gruca A , Grynberg M , Kajava AV , Promponas VJ , et al. 2019 . Tandem repeats lead to sequence assembly errors and impose multi-level challenges for genome and protein databases . Nucleic Acids Research 47 : 10994 – 11006 . OpenUrl CrossRef PubMed 71. ↵ Uehling J , Deveau A , Paoletti M . 2017 . Do fungi have an innate immune response? An NLR- based comparison to plant and animal immune systems . PLoS Pathogens 13 : 1 – 8 . OpenUrl CrossRef PubMed 72. ↵ Urbach JM , Ausubel FM . 2017 . The NBS-LRR architectures of plant R-proteins and metazoan NLRs evolved in independent events . Proc Natl Acad Sci USA 114 : 1063 – 1068 . OpenUrl Abstract / FREE Full Text 73. ↵ Urbina D , Tang B , Higgs PG . 2006 . The Response of Amino Acid Frequencies to Directional Mutation Pressure in Mitochondrial Genome Sequences Is Related to the Physical Properties of the Amino Acids and to the Structure of the Genetic Code . J Mol Evol 62 : 340 – 361 . OpenUrl CrossRef PubMed Web of Science 74. ↵ van der Gaag M , Debets AJMM , Oosterhof J , Slakhorst M , Thijssen JAGM , Hoekstra RF. 2000 . Spore-killing meiotic drive factors in a natural population of the fungus Podospora anserina . Genetics 156 : 593 – 605 . OpenUrl Abstract / FREE Full Text 75. ↵ van Diepeningen AD , Debets AJM , Slakhorst SM , Hoekstra RF. 2008 . Mitochondrial pAL2-1 plasmid homologs are senescence factors in Podospora anserina independent of intrinsic senescence . Biotechnology Journal 3 : 791 – 802 . OpenUrl CrossRef PubMed 76. ↵ Vogan AA , Ament-Velásquez SL , Bastiaans E , Wallerman O , Saupe SJ , Suh A , Johannesson H . 2021 . The Enterprise, a massive transposon carrying Spok meiotic drive genes . Genome Research 31 : 789 – 798 . OpenUrl Abstract / FREE Full Text 77. ↵ Vogan AA , Ament-Velásquez SL , Granger-Farbos A , Svedberg J , Bastiaans E , Debets AJ , Coustou V , Yvanne H , Clavé C , Saupe SJ , et al. 2019 . Combinations of Spok genes create multiple meiotic drivers in Podospora . eLife 8 : e46454 . OpenUrl CrossRef PubMed 78. ↵ Witek K , Jupe F , Witek AI , Baker D , Clark MD , Jones JDG . 2016 . Accelerated cloning of a potato late blight–resistance gene using RenSeq and SMRT sequencing . Nat Biotechnol 34 : 656 – 660 . OpenUrl CrossRef PubMed 79. ↵ Wojciechowski JW , Tekoglu E , Gąsior-Głogowska M , Coustou V , Szulc N , Szefczyk M , Kopaczyńska M , Saupe SJ , Dyrka W. 2022 . Exploring a diverse world of effector domains and amyloid signaling motifs in fungal NLR proteins ed. W.S. Noble . PLoS Comput Biol 18 : e1010787 . OpenUrl CrossRef PubMed 80. ↵ Wu J , Saupe SJ , Glass NL . 1998 . Evidence for balancing selection operating at the het-c heterokaryon incompatibility locus in a group of filamentous fungi . Proceedings of the National Academy of Sciences of the United States of America 95 : 12398 – 12403 . OpenUrl Abstract / FREE Full Text 81. ↵ Yoshimura SH , Hirano T . 2016 . HEAT repeats – versatile arrays of amphiphilic helices working in crowded environments? Journal of Cell Science 129 : 3963 – 3970 . OpenUrl Abstract / FREE Full Text 82. ↵ Yuen B , Bayes JM , Degnan SM . 2014 . The characterization of sponge NLRs provides insight into the origin and evolution of this innate immune gene family in animals . Molecular Biology and Evolution 31 : 106 – 120 . OpenUrl CrossRef PubMed Web of Science View the discussion thread. Back to top Previous Next Posted January 16, 2025. Download PDF Supplementary Material Data/Code Email Thank you for your interest in spreading the word about bioRxiv. NOTE: Your email address is requested solely to identify you as the sender of this article. Your Email * Your Name * Send To * Enter multiple addresses on separate lines or separate them with commas. You are going to email the following Reconstructing NOD-like receptor alleles with high internal conservation in Podospora anserina using long-read sequencing Message Subject (Your Name) has forwarded a page to you from bioRxiv Message Body (Your Name) thought you would like to see this page from the bioRxiv website. Your Personal Message CAPTCHA This question is for testing whether or not you are a human visitor and to prevent automated spam submissions. Share Reconstructing NOD-like receptor alleles with high internal conservation in Podospora anserina using long-read sequencing S. Lorena Ament-Velásquez , Brendan Furneaux , Sonia Dheur , Alexandra Granger-Farbos , Rike Stelkens , Hanna Johannesson , Sven J. Saupe bioRxiv 2025.01.13.632504; doi: https://doi.org/10.1101/2025.01.13.632504 Share This Article: Copy Citation Tools Reconstructing NOD-like receptor alleles with high internal conservation in Podospora anserina using long-read sequencing S. Lorena Ament-Velásquez , Brendan Furneaux , Sonia Dheur , Alexandra Granger-Farbos , Rike Stelkens , Hanna Johannesson , Sven J. Saupe bioRxiv 2025.01.13.632504; doi: https://doi.org/10.1101/2025.01.13.632504 Citation Manager Formats BibTeX Bookends EasyBib EndNote (tagged) EndNote 8 (xml) Medlars Mendeley Papers RefWorks Tagged Ref Manager RIS Zotero Tweet Widget Facebook Like Google Plus One Subject Area Genomics Subject Areas All Articles Animal Behavior and Cognition (7635) Biochemistry (17690) Bioengineering (13892) Bioinformatics (41936) Biophysics (21451) Cancer Biology (18588) Cell Biology (25499) Clinical Trials (138) Developmental Biology (13378) Ecology (19899) Epidemiology (2067) Evolutionary Biology (24320) Genetics (15609) Genomics (22506) Immunology (17736) Microbiology (40394) Molecular Biology (17181) Neuroscience (88603) Paleontology (666) Pathology (2832) Pharmacology and Toxicology (4824) Physiology (7641) Plant Biology (15152) Scientific Communication and Education (2045) Synthetic Biology (4294) Systems Biology (9825) Zoology (2271)
Text is read by the "Ask this paper" AI Q&A widget below.
Extraction quality varies by source — PMC NXML preserves structure
cleanly, OA-HTML may include some navigation residue, and OA-PDF can
have broken hyphenation. The publisher copy
(via DOI)
is the canonical version.