Full text
35,341 characters
· extracted from
preprint-html
· click to expand
Structural Analysis and Docking Studies of FK506-Binding Protein 1A | bioRxiv /* */ /* */ <!-- <!-- /*! * yepnope1.5.4 * (c) WTFPL, GPLv2 */ (function(a,b,c){function d(a){return"[object Function]"==o.call(a)}function e(a){return"string"==typeof a}function f(){}function g(a){return!a||"loaded"==a||"complete"==a||"uninitialized"==a}function h(){var a=p.shift();q=1,a?a.t?m(function(){("c"==a.t?B.injectCss:B.injectJs)(a.s,0,a.a,a.x,a.e,1)},0):(a(),h()):q=0}function i(a,c,d,e,f,i,j){function k(b){if(!o&&g(l.readyState)&&(u.r=o=1,!q&&h(),l.onload=l.onreadystatechange=null,b)){"img"!=a&&m(function(){t.removeChild(l)},50);for(var d in y[c])y[c].hasOwnProperty(d)&&y[c][d].onload()}}var j=j||B.errorTimeout,l=b.createElement(a),o=0,r=0,u={t:d,s:c,e:f,a:i,x:j};1===y[c]&&(r=1,y[c]=[]),"object"==a?l.data=c:(l.src=c,l.type=a),l.width=l.height="0",l.onerror=l.onload=l.onreadystatechange=function(){k.call(this,r)},p.splice(e,0,u),"img"!=a&&(r||2===y[c]?(t.insertBefore(l,s?null:n),m(k,j)):y[c].push(l))}function j(a,b,c,d,f){return q=0,b=b||"j",e(a)?i("c"==b?v:u,a,b,this.i++,c,d,f):(p.splice(this.i++,0,a),1==p.length&&h()),this}function k(){var a=B;return a.loader={load:j,i:0},a}var l=b.documentElement,m=a.setTimeout,n=b.getElementsByTagName("script")[0],o={}.toString,p=[],q=0,r="MozAppearance"in l.style,s=r&&!!b.createRange().compareNode,t=s?l:n.parentNode,l=a.opera&&"[object Opera]"==o.call(a.opera),l=!!b.attachEvent&&!l,u=r?"object":l?"script":"img",v=l?"script":u,w=Array.isArray||function(a){return"[object Array]"==o.call(a)},x=[],y={},z={timeout:function(a,b){return b.length&&(a.timeout=b[0]),a}},A,B;B=function(a){function b(a){var a=a.split("!"),b=x.length,c=a.pop(),d=a.length,c={url:c,origUrl:c,prefixes:a},e,f,g;for(f=0;f<d;f++)g=a[f].split("="),(e=z[g.shift()])&&(c=e(c,g));for(f=0;f<b;f++)c=x[f](c);return c}function g(a,e,f,g,h){var i=b(a),j=i.autoCallback;i.url.split(".").pop().split("?").shift(),i.bypass||(e&&(e=d(e)?e:e[a]||e[g]||e[a.split("/").pop().split("?")[0]]),i.instead?i.instead(a,e,f,g,h):(y[i.url]?i.noexec=!0:y[i.url]=1,f.load(i.url,i.forceCSS||!i.forceJS&&"css"==i.url.split(".").pop().split("?").shift()?"c":c,i.noexec,i.attrs,i.timeout),(d(e)||d(j))&&f.load(function(){k(),e&&e(i.origUrl,h,g),j&&j(i.origUrl,h,g),y[i.url]=2})))}function h(a,b){function c(a,c){if(a){if(e(a))c||(j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}),g(a,j,b,0,h);else if(Object(a)===a)for(n in m=function(){var b=0,c;for(c in a)a.hasOwnProperty(c)&&b++;return b}(),a)a.hasOwnProperty(n)&&(!c&&!--m&&(d(j)?j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}:j[n]=function(a){return function(){var b=[].slice.call(arguments);a&&a.apply(this,b),l()}}(k[n])),g(a[n],j,b,n,h))}else!c&&l()}var h=!!a.test,i=a.load||a.both,j=a.callback||f,k=j,l=a.complete||f,m,n;c(h?a.yep:a.nope,!!i),i&&c(i)}var i,j,l=this.yepnope.loader;if(e(a))g(a,0,l,0);else if(w(a))for(i=0;i (function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0];var j=d.createElement(s);var dl=l!='dataLayer'?'&l='+l:'';j.src='//www.googletagmanager.com/gtm.js?id='+i+dl;j.type='text/javascript';j.async=true;f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-M677548'); Skip to main content Home About Submit ALERTS / RSS Search for this keyword Advanced Search New Results Structural Analysis and Docking Studies of FK506-Binding Protein 1A Omur Guven , View ORCID Profile Hasan DeMirci doi: https://doi.org/10.1101/2025.05.22.655516 Omur Guven 1 Koc University Find this author on Google Scholar Find this author on PubMed Search for this author on this site Hasan DeMirci 2 SLAC National Laboratory Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Hasan DeMirci For correspondence: hasan_demirci{at}stanford.edu Abstract Full Text Info/History Metrics Preview PDF ABSTRACT FK-binding protein 1A, a member of immunophilin family of proteins, is a protein with a wide variety of roles in cellular processes, including regulation of immune system, calcium intake metabolism through ryanodine receptors, TGF-β signaling and EGFR regulation. As a protein originally defined as the cellular target of premier immunosuppresant drugs, FK506 and Rapamycin, it has been a protein studied for further pharmacological uses. In this study, we have overexpressed, purified and crystallized apo-FKBP1A. Here, we are showing the FKBP1A crystal structure, calculated at cryogenic temperature at a very high resolution of 1.05 Å, obtained with a home source X-ray ‘Turkish DeLight’. Docking studies, with drug repurposing in mind were carried out with Molegro Virtual Docker software. Docking results will prove useful in future pharmaceutical studies done on FKBP1A, and similar proteins. 1. INTRODUCTION FKBP1A (FKBP12), a member of the FK506-binding protein family, plays critical roles in cellular functions, including immunosuppression, calcium signaling, and protein regulation through proline cis-trans isomerization. FKBP proteins catalyze the interconversion of proline’s peptide bonds between cis and trans conformations, which profoundly influences protein structure and function. Among its diverse functions, FKBP1A interacts with immunosuppressive drugs FK506 and rapamycin, eliciting distinct cellular responses. FK506 inhibits calcineurin, preventing NFAT-mediated T cell activation, while rapamycin inhibits mTORC1, affecting cell growth and memory T cell differentiation [ Tong et al, 2015 ; Kasahara et al, 2021 ]. These mechanisms underline FKBP1A’s importance in immune modulation. FKBP1A’s regulatory roles extend beyond immunosuppression. It stabilizes ryanodine receptors (RyRs), which regulate calcium release from the endoplasmic and sarcoplasmic reticulum, essential for cardiac excitation-contraction coupling. Dysregulation of this interaction may lead to arrhythmias or heart failure [ Gonano et al, 2017 ]. Additionally, FKBP1A interacts with Transforming Growth Factor-β (TGF-β) receptors, particularly regulating activin-receptor-like kinase (ALK) in the bone morphogenetic protein (BMP) pathway [ Stockwell et al, 1998 ; Quist-Løkken et al, 2021 ]. This role extends its relevance to autophagy and cancer, where FKBP1A acts as a biomarker and influences the ubiquitination and degradation of MDM2, a regulator of the tumor suppressor p53 [ Li et al, 2022 : Cai et al, 2022 ]. Furthermore, FKBP1A modulates the autophosphorylation of the Epidermal Growth Factor Receptor (EGFR), highlighting its multifaceted regulatory capacity [ Mathea et al, 2011 ]. In neurodegenerative diseases, FKBP1A’s role has garnered significant attention. Lower FKBP1A levels have been observed in Alzheimer’s disease (AD) brains, while elevated levels are found in neurofibrillary tangles and other pathologies [ Caminati et al, 2020 ; Chattopadhaya et al, 2011 ]. FKBP1A interacts with α-synuclein, accelerating its aggregation into fibrils associated with Parkinson’s disease (PD). This interaction exacerbates neurodegenerative processes, suggesting that FKBP1A inhibition could have therapeutic potential. Moreover, FKBP1A may regulate tau phosphorylation, contributing to aberrant protein folding and transport impairments characteristic of AD. Its interaction with calcineurin further implicates FKBP1A in calcium signaling dysregulation, a hallmark of neurodegeneration [ Avramut et al, 2002 ] . Innovative detection methods, including nanostructured platforms, offer promise for FKBP1A’s use as a biomarker in neurodegenerative disease screening and therapeutic development. FKBP1A also plays a pivotal role in cancer development and therapy. It modulates key signaling pathways, including TGF-β, apoptosis, and angiogenesis. For example, FKBP1A’s interaction with the TGF-β receptor suppresses tumor-promoting signaling under normal conditions. Loss of FKBP1A’s regulatory function has been linked to poor prognosis in cancers such as breast cancer and liver hepatocellular carcinoma (LIHC) [ Romano et al, 2015 ; Solassol et al, 2011 ]. High FKBP1A expression in LIHC correlates with advanced tumor stages and poor survival rates, while its loss in breast cancer predicts resistance to anthracycline-based therapies [ Theuerkorn et al, 2011 ; Romano et al, 2010 ]. Additionally, FKBP1A’s role in regulating HIF-2α and EGFR underscores its contribution to tumorigenesis through angiogenesis and apoptosis resistance [ Yao et al, 2011 ; Xing et al, 2019 ]. Emerging research suggests that FKBP family members, including FKBP1A, are valuable biomarkers and therapeutic targets across cancer types. Structurally, FKBP1A’s functions are closely tied to its ability to bind ligands and regulate protein interactions. High-resolution studies of FKBP1A at cryogenic temperatures provide critical insights into its regulatory mechanisms [ Li et al, 2022 ]. Understanding these structural details advances its application in therapeutic contexts, whether targeting immune pathways, neurodegenerative diseases. Overall, FKBP1A is a versatile protein with extensive roles in cellular regulation, disease progression, and therapeutic potential. Its involvement in diverse signaling pathways makes it a crucial target for future research aimed at understanding and manipulating its functions for clinical benefit. 2 METHODS 2.1 Transformation and Expression FKBP1A with the sequence “GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKK FDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPH ATLVFDVELLKLE” was cloned into pET28a (+) vector with an N-terminal hexahistidine purification tag with a Thrombin cut site. As a cloning restriction enzyme cut sites, HindIII and KpnI were chosen and the Kanamycin resistance gene was used as a selection marker. The constructed plasmid was transformed into competent Escherichia coli (E. coli) BL21 Rosetta-2 strain, with heat shock method. Transformed bacterial cells were grown in 18 L regular LB media containing 50 µg/mL kanamycin and 35 µL/mL chloramphenicol at 37 °C. At OD600 value of 0.8, the protein expression was induced by using β-D-1-thiogalactopyranoside (IPTG) at a final concentration of 0.4 mM for 18 h at 18 °C. Cell harvesting was done using Beckman Allegra 15 R desktop centrifuge at 4 °C at 3500 rpm for 45 min. Cell pellets were stored at −45°C until protein purification. 2.2 Purification The cells were dissolved in lysis buffer containing 500 mM NaCl, 50 mM Tris-HCl pH 7.5, 10% (v/v) Glycerol, 0.1% (v/v) Triton X-100, 2 mM BME, and 10 µM ZnCl2. The homogenized cells were lysed using a Branson W250 sonifier (Brookfield, CT, USA). The cell lysate was centrifuged at 4 °C at 35000 rpm for 1 h with Beckman Optima™ L-80XP Ultracentrifuge equipped with Ti45 rotor (Beckman, Brea, CA, USA). The pellet containing membranes and cell debris was discarded. The supernatant containing the soluble protein was filtered through 0.2 micron hydrophilic membrane and loaded to a Ni-NTA column that was previously equilibrated with a wash buffer containing 250 mM NaCl, 20 mM Tris-HCl pH 7.5 and 20 mM Imidazole. Unbound proteins were discarded by washing the column using a wash buffer. Then, the target protein (FKBP1A) was eluted using an elution buffer containing 250 mM NaCl, 20 mM Tris-HCl pH 7.5, 250 mM Imidazole,. Then, the eluted FKBP1A protein was dialyzed in a dialysis membrane (3 kDa MWCO) against a buffer with the same composition as the wash buffer for 3 h at 4 °C to remove excess imidazole. Dialyzed FKBP1A protein was cut using Thrombin protease to remove the hexahistidine-tag overnight at 4 °C. 2.3 Crystallization The crystallization screening of N-terminal hexahistidine cleaved FKBP1A was performed using the sitting-drop microbatch under oil method against ∼3000 commercially available sparse matrix crystallization screening conditions in a 1:1 volumetric ratio in 72-Terasaki plates (Greiner Bio-One, Kremsmünster, Austria) as described in Ertem 2021 et al. [ Ertem, 2022 ] . The mixtures were covered with 16.6 µL 100% paraffin oil (Tekkim Kimya, Istanbul, Türkiye). The crystallization plates were incubated at 4 °C and checked frequently under a stereo light microscope. The best FKBP1A crystals were grown within three months in NR LBD condition #48 (Molecular Dimensions, USA). This condition contains 2.0 M Ammonium Sulfate, 0.2 M Sodium Chloride and 0.1M TRIS 8.0. 2.4 Crystal Harvesting and Delivery The FKBP1A crystals were harvested using MiTeGen MicroLoops attached to a magnetic wand [ Garman, 2006 ] while being monitored under microscope [ Atalay, 2023 ] . The obtained crystals were flash frozen by plunging in liquid nitrogen and placed in a cryo-cooled sample storage puck (Cat#M-CP-111-021, MiTeGen, USA). Then, the puck was placed into the Turkish DeLight liquid nitrogen-filled autosample dewar at 100 K. 2.5 Data Collection and Data Reduction Collection of diffraction data from the FKBP1A crystal was performed by utilizing Rigaku’s XtaLAB Synergy Flow XRD source “ Turkish DeLight ” at University of Health Sciences (Istanbul, Türkiye) with CrysAlisPro software 1.171.42.35a [22] . The crystals were kept cooled by the Cryostream 800 Plus system, which was set to 100 K. The PhotonJet-R X-ray generator operated at 30 mA, 1200.0 W, and 40 kV with 10% beam intensity. The data was collected at 1.54 Å wavelength and the detector distance was set to 47.00 mm. The crystal oscillation width was set to 0.25 degrees per image while exposure time was 20.0 min. CrysAlis Pro version 1.171.42.35a [22] was utilized to perform data reduction and an *.mtz file was obtained as the result. 2.6 Structure Determination and Refinement The cryogenic TRAF6 structure was determined at 1.05 Å with the space group C121 utilizing PHASER 2.8.3 [ McCoy, 2007 ], an automated molecular replacement program within the PHENIX suite 1.20.1 [ Adams, 2010 ]. An AlphaFold generated FKBP1A structure was used as an initial search model for molecular replacement. Simulated annealing and rigid-body refinements were performed during the first refinement cycle including individual coordinates and translation/liberates/screw (TLS) parameters were refined. The structure was checked by COOT [ Emsley, 2004 ] after each set of refinement and the solvent molecules were added into unfilled, appropriate electron density maps. The obtained final structure was examined by using PyMOL [26] 2.5.4 and COOT 0.9.8, and the figures were created. Data collection and refinement statistics were given in Table 1 . View this table: View inline View popup Table 1. Data collection and refinement statistics. 2.7 Molecular Docking After Traf6 structure was determined with home source, at cryogenic temperature, molecular docking was done by utilizing Molegro Virtual Docker(MVD) [ Bittencout-Ferreira, 2019 ]. For this step, entire FDA database was obtained from Drugbank server [ Knox, 2024 ]. Then, the active sites on Traf6 were determined using MVD and the docking procedure was followed. 3 RESULTS 3.1 FKBP1A Structure at 1.05 A FKBP1A is a 24 kDa dimerized protein and here we present a cryogenic temperature full length structure at 1.05 Å. (Figure) The presented structure is also deposited to Protein Database (PDB) with the accession code 8X6P. Download figure Open in new tab Figure 1: Overall structure of FKBP1A with sulfate ions present. These sulfate ions come from the crystallization condition (NR LBD-II, #48) which includes Ammonium Sulfate. As we look into the sulfate ions in detail, we can see that they are interacting with Ala85 and Thr86, located in the loop region. Download figure Open in new tab Figure 2: Sulfate interaction with Ala85 and Thr86. (A,C) Distances between SO4 and interacting ions in Chain A and Chain B, respectively, shown with electron density maps at sigma level of 4.0 (B,D) Electron density maps showing the sulfate and the interacting residues in Chain A and Chain B, respectively, with the surrounding solvent residues. 3.2 Structural Alignment with Reference Model The AlphaFold model used for molecular replacement was aligned with the determined FKBP1A structure. As the model is a monomeric structure, we have aligned with Chain A of our structure here. Two structures align with a RMSD value of 0.263, with the main diffraction being the sulfate ion in our structure. Download figure Open in new tab Figure 3: FKBP1A Chain A aligned to AlphaFold model with RMSD 0.263. Our structure has a sulfate ion, while the model structure does not possess one. Molecular Docking for FKBP1A The FDA database, obtained from Drugbank, was screened on the full length FKBP1A (PDB accession code: 8X6P) by using Molegro Virtual Docker (MVD). For this analysis, the possible binding pockets were determined first, and the pocket between the two chains were selected as the target. Then, 3353 compounds were screened in this pocket, and were ranked based on their ‘Rerank score’, a function of MVD. Shared in Table 2 is the Rerank scores and molecular weights for top 10 candidates. View this table: View inline View popup Download powerpoint Table 2: Rerank scores and molecular weights of the top 10 candidates of molecular docking. These rerank scores are calculated as the summation of different binding free energies of intermolecular interactions. These interactions can be categorized as protein-ligand, cofactor-ligand and solvent(water)-ligand. In this case, the cofactor is the sulfate ion, shown in the structure. These values are shown in Table 3 . View this table: View inline View popup Download powerpoint Table 3: Intermolecular energy calculations for top 10 compounds. Docking studies also show the interactions ‘opposing’ the pose, such as clashes. These values could be important, as they can arise from an unfavorable pose for the compound. It should be noted that these values are related to the conformation of the compound only, instead of being an indication of how well they are bound to the protein. Intramolecular energy values are shown in Table 4 . View this table: View inline View popup Download powerpoint Table 4: Intramolecular energy calculations for top 10 compounds. 3.3 Visualization and Ligand Interaction Maps of Top 10 Compounds Once the top 10 cancidates are determined based on their rerank score, a more detailed examination was done on how they might interact with the receptor protein. For this purpose, the poses and the receptor protein (FKBP1A) were exported and were analyzed using Biovia Discovery Studio and PyMOL software suite. Download figure Open in new tab Figure 4: Proposed ADP and Unknown_543 bindings to FKBP1A and ligand interaction map. Residues from both chains are visualized here, and 2D interaction map shows hydrogen bonds, van der Waals interactions, interacting solvents and steric clashes. Download figure Open in new tab Figure 5: Proposed Ceforanide and Etidronate bindings to FKBP1A and ligand interaction map. Residues from both chains are visualized here, and 2D interaction map shows hydrogen bonds, van der Waals interactions, interacting solvents and steric clashes. Download figure Open in new tab Figure 6: Proposed Unknown_285 and Ceftibuten bindings to FKBP1A and ligand interaction map. Residues from both chains are visualized here, and 2D interaction map shows hydrogen bonds, van der Waals interactions, interacting solvents and steric clashes. Download figure Open in new tab Figure 7: Proposed AMP and Fludara bindings to FKBP1A and ligand interaction map. Residues from both chains are visualized here, and 2D interaction map shows hydrogen bonds, van der Waals interactions, interacting solvents and steric clashes. Download figure Open in new tab Figure 8: Proposed Unknown_192 and Ibandronate binding to FKBP1A and ligand interaction map. Residues from both chains are visualized here, and 2D interaction map shows hydrogen bonds, van der Waals interactions, interacting solvents and steric clashes. 4 DISCUSSION FK506 Binding Protein (FKBP) family is a group of proteins with a wide array of roles, including immune system mediation, cell cycle regulation, neuronal signaling and neurodegeneration. Founding member of this family, FKBP1A, is a 12 kDa protein with a wide variety of cellular functions [ Hausch, 2015 ] and a high conservation rate FKBP1A has a unique role as a peptidyl prolyl cis-trans isomerase, where it regulates the proline N-terminal peptide bond conformation. As the structure and the function of the protein is affected by this conformational change, FKBP1A is deemed to have a role in folding and regulation of especially proline rich proteins. It is also known for its role in stabilization of ryanodine receptors, preventing Ca +2 ions from endoplasmic reticulum. [ Gant, 2014 ] In heart, altered levels of Ca ++ can cause arrythmia and heart failure, thus demonstrating the importance of mediation. FKBP1A is also shown as a cellular interactor or TGF-ß Type I receptors, such as BMPs. FKBP1A is also involved in various neurodegenerative diseases. In Alzheimer’s patients, FKBP1A is shown to colocalize in brain with neurofibrillatory tangles. It is also shown to interact with Amyloid Precursor Protein (APP). [ Cao, 2011 ] In patients with Parkinson’s Disease, there is a connection between FKBP1A and α-Synuclein. [ Gerard, 2011 ] It can also have a role in other tauopathies. [ Koren, 2011 ] FKBP1A is thought to be involved in these diseases as it has a Peptidyl-prolyl cis-trans isomerase function. In addition to its physiological roles, FKBP1A is a known target of common immunosuppressants, namely Rapamycin and FK506. These two drugs bind to the same protein, yet they trigger different cellular processes. Rapamycin binding to FKBP1A regulates mTOR pathway, a premier pathway involved in many cellular processes, such as cell cycle and cell survival. FK506 binding regulates calmodulin dependent calcineurin inhibition, which in turn affects the activity of NF-AT, a nuclear factor with a variety of roles in immune system regulation. [ Zissimopolus, 2021 ] Our FKBP1A model has two monomers in the asymmetric unit, and a pocket drawn between these two monomers during docking. The results show similar residues interacting with these compounds, such as a Lys53 residue in Chain B forming a hydrogen bond with 7 of them. On the other hand, the same residue causes a steric clash with two of the compounds. Last compound forms a van der Waals interaction with Lys53. Another such residue is Arg19 in Chain B, forming a hydrogen bond with four compounds, and a pi-cation interaction with 2 other. It causes a steric clash with 3 compounds, and a van der Waals interaction with the last one. In Chain A, Arg 72 seems to be a key residue, forming a hydrogen bond with four compounds, and causing a clash with three others. It forms a van der Waals interaction with two compounds, and a pi-cation interaction with the last. These three residues seem commonly interacting with the docked compounds, as illustrated here in ligand interaction maps. It is important to note that, this is the first reported FKBP1A structure with multiple chains and a sulfate ion, and the docking results also take these factors into account. These findings and analyses could be important in studying the inhibition and uncovering new roles of FKBP1A in cellular processes. Acknowledgement The authors gratefully acknowledge use of the services and facilities of the Koç University Isbank Infectious Disease Center (KUISCID), and Health Sciences University (SBÜ). H.D. acknowledges support from NSF Science and Technology Center grant NSF-1231306 (Biology with X-ray Lasers, BioXFEL). Ö.G. acknowledges support from the Scientific and Technological Research Council of Türkiye (TÜBİTAK, 2218 - National Postdoctoral Research Fellowship Program under project number 118C476). This publication has been produced benefiting from the 2232 International Fellowship for Outstanding Researchers Program and the 1001 Scientific and Technological Research Projects Funding Program of the TÜBİTAK (Project Nos. 118C270 and 120Z520). However, the entire responsibility of the publication belongs to the authors of the publication. The financial support received from TÜBİTAK does not mean that the content of the publication is approved in a scientific sense by TÜBİTAK. REFERENCES 1. ↵ Tong M , Jiang Y . FK506-Binding Proteins and Their Diverse Functions . Curr Mol Pharmacol [Internet] . 2015 Dec 14 [cited cited 2025 Feb 2] ; 9 ( 1 ): 48 . Available from: https://pmc.ncbi.nlm.nih.gov/articles/PMC6611466/ OpenUrl CrossRef 2. ↵ Kasahara K . Physiological function of FKBP12, a primary target of rapamycin/FK506: a newly identified role in transcription of ribosomal protein genes in yeast . Curr Genet [Internet] . 2021 Jun 1 [cited cited 2025 Feb 2] ; 67 ( 3 ): 383 – 8 . Available from: https://link.springer.com/article/10.1007/s00294-020-01142-3 OpenUrl CrossRef 3. ↵ Gonano LA , Jones PP . FK506-binding proteins 12 and 12.6 (FKBPs) as regulators of cardiac Ryanodine Receptors: Insights from new functional and structural knowledge . Channels [Internet] . 2017 Sep 3 [cited cited 2025 Feb 2] ; 11 ( 5 ): 415 . Available from: https://pmc.ncbi.nlm.nih.gov/articles/PMC5626368/ OpenUrl CrossRef 4. ↵ Stockwell BR , Schreiber SL . TGF-beta-signaling with small molecule FKBP12 antagonists that bind myristoylated FKBP12-TGF-beta type I receptor fusion proteins . Chem Biol [Internet] . 1998 [cited 2025 Feb 2] ; 5 ( 7 ): 385 – 95 . Available from: https://pubmed.ncbi.nlm.nih.gov/9662508/ OpenUrl CrossRef 5. ↵ Quist-Løkken I , Andersson-Rusch C , Kastnes MH , Kolos JM , Jatzlau J , Hella H , et al. FKBP12 is a major regulator of ALK2 activity in multiple myeloma cells . Cell Communication and Signaling [Internet] . 2023 Dec 1 [cited cited 2025 Feb 2] ; 21 ( 1 ): 1 – 16 . Available from: https://biosignaling.biomedcentral.com/articles/10.1186/s12964-022-01033-9 OpenUrl CrossRef 6. ↵ Li Z , Cui Y , Duan Q , Zhang J , Shao D , Cao X , et al. The Prognostic Significance of FKBP1A and Its Related Immune Infiltration in Liver Hepatocellular Carcinoma . Int J Mol Sci [Internet] . 2022 Nov 1 [cited cited 2025 Feb 2] ; 23 ( 21 ). Available from: https://pubmed.ncbi.nlm.nih.gov/36361587/ 7. ↵ Cai S , Chen Z , Tang H , Meng S , Tao L , Wang Q . Upregulated FKBP1A Suppresses Glioblastoma Cell Growth via Apoptosis Pathway . Int J Mol Sci [Internet] . 2022 Dec 1 [cited cited 2025 Feb 2] ; 23 ( 23 ). Available from: https://pubmed.ncbi.nlm.nih.gov/36499275/ 8. ↵ Mathea S , Li S , Schierhorn A , Jahreis G , Schiene-Fischer C . Suppression of EGFR autophosphorylation by FKBP12 . Biochemistry [Internet] . 2011 Dec 20 [cited cited 2025 Feb 2] ; 50 ( 50 ): 10844 – 50 . Available from: https://pubs.acs.org/doi/abs/10.1021/bi2013855 OpenUrl 9. ↵ Caminati G , Procacci P . Mounting evidence of FKBP12 implication in neurodegeneration . Neural Regen Res [Internet] . 2020 Dec 1 [cited cited 2025 Feb 2] ; 15 ( 12 ): 2195 . Available from: https://pmc.ncbi.nlm.nih.gov/articles/PMC7749462/ OpenUrl CrossRef 10. ↵ Chattopadhaya S , Harikishore A , S. Yoon H . Role of FK506 binding proteins in neurodegenerative disorders . Curr Med Chem [Internet] . 2011 Nov 21 [cited cited 2025 Feb 2] ; 18 ( 35 ): 5380 – 97 . Available from: https://pubmed.ncbi.nlm.nih.gov/22087831/ OpenUrl CrossRef 11. ↵ Avramut M , Achim CL . Immunophilins and their ligands: Insights into survival and growth of human neurons . Physiol Behav [Internet] . 2002 [cited 2025 Feb 2] ; 77 ( 4–5 ): 463 – 8 . Available from: https://pubmed.ncbi.nlm.nih.gov/12526984/ OpenUrl CrossRef 12. ↵ Romano S , D’Angelillo A , Romano MF . Pleiotropic roles in cancer biology for multifaceted proteins FKBPs . Biochim Biophys Acta [Internet] . 2015 Oct 31 [cited cited 2025 Feb 2] ; 1850 ( 10 ): 2061 – 8 . Available from: https://pubmed.ncbi.nlm.nih.gov/25592270/ OpenUrl CrossRef 13. ↵ Solassol J , Mange A , Maudelonde T . FKBP family proteins as promising new biomarkers for cancer . Curr Opin Pharmacol . 2011 Aug 1 ; 11 ( 4 ): 320 – 5 . OpenUrl CrossRef PubMed 14. ↵ Theuerkorn M , Fischer G , Schiene-Fischer C . Prolyl cis/trans isomerase signalling pathways in cancer . Curr Opin Pharmacol [Internet] . 2011 [cited 2025 Feb 2] ; 11 ( 4 ): 281 – 7 . Available from: https://pubmed.ncbi.nlm.nih.gov/21497135/ OpenUrl CrossRef 15. ↵ Romano S , Di Pace A , Sorrentino A , Bisogni R , Sivero L , Fiammetta Romano M . FK506 binding proteins as targets in anticancer therapy . Anticancer Agents Med Chem [Internet] . 2010 Aug 14 [cited cited 2025 Feb 2] ; 10 ( 9 ): 651 – 6 . Available from: https://pubmed.ncbi.nlm.nih.gov/21182472/ OpenUrl CrossRef 16. ↵ Yao YL , Liang YC , Huang HH , Yang WM . FKBPs in chromatin modification and cancer . Curr Opin Pharmacol [Internet] . 2011 [cited 2025 Feb 2] ; 11 ( 4 ): 301 – 7 . Available from: https://pubmed.ncbi.nlm.nih.gov/21489876/ OpenUrl CrossRef 17. ↵ Xing M , Wang J , Yang Q , Wang Y , Li J , Xiong J , et al. FKBP12 is a predictive biomarker for efficacy of anthracycline-based chemotherapy in breast cancer . Cancer Chemother Pharmacol [Internet] . 2019 Oct 1 [cited cited 2025 Feb 2] ; 84 ( 4 ): 861 – 72 . Available from: https://pubmed.ncbi.nlm.nih.gov/31428819/ OpenUrl CrossRef 18. ↵ Ertem FB , Guven O , Buyukdag C , Gocenler O , Ayan E , Yuksel B , et al. Protocol for structure determination of SARS-CoV-2 main protease at near-physiological-temperature by serial femtosecond crystallography . STAR Protoc . 2022 Mar 18 ; 3 ( 1 ): 101158 . OpenUrl CrossRef PubMed 19. ↵ Garman EF , Owen RL . Cryocooling and radiation damage in macromolecular crystallography . Acta Crystallogr D Biol Crystallogr [Internet] . 2006 Jan [cited 2025 Feb 2] ; 62 ( Pt 1 ): 32 – 47 . Available from: https://pubmed.ncbi.nlm.nih.gov/16369092/ OpenUrl CrossRef 20. ↵ Atalay N , Akcan EK , Gül M , Ayan E , Destan E , Ertem FB , et al. Cryogenic X-ray crystallographic studies of biomacromolecules at Turkish Light Source “ Turkish DeLight.” Turk J Biol [Internet] . 2023 [cited 2025 Feb 2] ; 47 ( 1 ). Available from: https://pubmed.ncbi.nlm.nih.gov/37529114/ 21. ↵ McCoy AJ , Grosse-Kunstleve RW , Adams PD , Winn MD , Storoni LC , Read RJ. Phaser crystallographic software . J Appl Crystallogr [Internet] . 2007 Jul 13 [cited cited 2025 Feb 2] ; 40 ( Pt 4 ): 658 – 74 . Available from: https://pubmed.ncbi.nlm.nih.gov/19461840/ OpenUrl CrossRef 22. ↵ Adams PD , Afonine P V. , Bunkóczi G , Chen VB , Davis IW , Echols N , et al. PHENIX: a comprehensive Python-based system for macromolecular structure solution . Acta Crystallogr D Biol Crystallogr [Internet] . 2010 [cited 2025 Feb 2] ; 66 ( Pt 2 ): 213 – 21 . Available from: https://pubmed.ncbi.nlm.nih.gov/20124702/ OpenUrl CrossRef 23. ↵ Emsley P , Cowtan K . Coot: model-building tools for molecular graphics . Acta Crystallogr D Biol Crystallogr [Internet] . 2004 Dec [cited 2025 Feb 2];60(Pt 12 Pt 1):2126–32 . Available from: https://pubmed.ncbi.nlm.nih.gov/15572765/ 24. ↵ Bitencourt-Ferreira G , de Azevedo WF . Molegro Virtual Docker for Docking . Methods Mol Biol [Internet] . 2019 [cited 2025 Feb 2] ; 2053 : 149 – 67 . Available from: https://pubmed.ncbi.nlm.nih.gov/31452104/ OpenUrl CrossRef 25. ↵ Knox C , Wilson M , Klinger CM , Franklin M , Oler E , Wilson A , et al. DrugBank 6.0: the DrugBank Knowledgebase for 2024 . Nucleic Acids Res [Internet] . 2024 Jan 5 [cited cited 2025 Feb 2] ; 52 ( D1 ): D1265 – 75 . Available from: https://pubmed.ncbi.nlm.nih.gov/37953279/ OpenUrl CrossRef 26. ↵ Hausch F . FKBPs and their role in neuronal signaling . Biochim Biophys Acta [Internet] . 2015 Oct 1 [cited cited 2025 Feb 2] ; 1850 ( 10 ): 2035 – 40 . Available from: https://pubmed.ncbi.nlm.nih.gov/25615537/ OpenUrl CrossRef 27. ↵ Gant JC , Blalock EM , Chen KC , Kadish I , Porter NM , Norris CM , et al. FK506-binding protein 1b/12.6: a key to aging-related hippocampal Ca2+ dysregulation? Eur J Pharmacol [Internet] . 2014 Sep 15 [cited cited 2025 Feb 2] ; 739 ( C ): 74 – 82 . Available from: https://pubmed.ncbi.nlm.nih.gov/24291098/ OpenUrl CrossRef 28. ↵ Cao W , Konsolaki M . FKBP immunophilins and Alzheimer’s disease: A chaperoned affair . J Biosci [Internet] . 2011 Aug 23 [cited cited 2025 Feb 2] ; 36 ( 3 ): 493 – 8 . Available from: https://link.springer.com/article/10.1007/s12038-011-9080-7 OpenUrl 29. ↵ Gerard M , Deleersnijder A , Demeulemeester J , Debyser Z , Baekelandt V . Unraveling the Role of Peptidyl-Prolyl Isomerases in Neurodegeneration . Molecular Neurobiology 2011 44:1 [Internet] . 2011 May 7 [cited cited 2025 Feb 2] ; 44 ( 1 ): 13 – 27 . Available from: https://link.springer.com/article/10.1007/s12035-011-8184-2 OpenUrl CrossRef 30. ↵ Koren J , Jinwal UK , Davey Z , Kiray J , Arulselvam K , Dickey CA . Bending tau into shape: the emerging role of peptidyl-prolyl isomerases in tauopathies . Mol Neurobiol [Internet] . 2011 [cited 2025 Feb 2] ; 44 ( 1 ): 65 – 70 . Available from: https://pubmed.ncbi.nlm.nih.gov/21523562/ OpenUrl CrossRef 31. ↵ Zissimopoulos S , Seifan S , Maxwell C , Williams AJ , Lai FA . Disparities in the association of the ryanodine receptor and the FK506-binding proteins in mammalian heart . J Cell Sci [Internet] . 2012 [cited 2025 Feb 2] ; 125 ( Pt 7 ): 1759 – 69 . Available from: https://pubmed.ncbi.nlm.nih.gov/22328519/ OpenUrl View the discussion thread. Back to top Previous Next Posted May 23, 2025. Download PDF Email Thank you for your interest in spreading the word about bioRxiv. NOTE: Your email address is requested solely to identify you as the sender of this article. Your Email * Your Name * Send To * Enter multiple addresses on separate lines or separate them with commas. You are going to email the following Structural Analysis and Docking Studies of FK506-Binding Protein 1A Message Subject (Your Name) has forwarded a page to you from bioRxiv Message Body (Your Name) thought you would like to see this page from the bioRxiv website. Your Personal Message CAPTCHA This question is for testing whether or not you are a human visitor and to prevent automated spam submissions. Share Structural Analysis and Docking Studies of FK506-Binding Protein 1A Omur Guven , Hasan DeMirci bioRxiv 2025.05.22.655516; doi: https://doi.org/10.1101/2025.05.22.655516 Share This Article: Copy Citation Tools Structural Analysis and Docking Studies of FK506-Binding Protein 1A Omur Guven , Hasan DeMirci bioRxiv 2025.05.22.655516; doi: https://doi.org/10.1101/2025.05.22.655516 Citation Manager Formats BibTeX Bookends EasyBib EndNote (tagged) EndNote 8 (xml) Medlars Mendeley Papers RefWorks Tagged Ref Manager RIS Zotero Tweet Widget Facebook Like Google Plus One Subject Area Biochemistry Subject Areas All Articles Animal Behavior and Cognition (7633) Biochemistry (17680) Bioengineering (13889) Bioinformatics (41927) Biophysics (21445) Cancer Biology (18585) Cell Biology (25491) Clinical Trials (138) Developmental Biology (13373) Ecology (19897) Epidemiology (2067) Evolutionary Biology (24308) Genetics (15606) Genomics (22494) Immunology (17736) Microbiology (40385) Molecular Biology (17175) Neuroscience (88583) Paleontology (666) Pathology (2830) Pharmacology and Toxicology (4822) Physiology (7641) Plant Biology (15149) Scientific Communication and Education (2045) Synthetic Biology (4293) Systems Biology (9822) Zoology (2271)
Text is read by the "Ask this paper" AI Q&A widget below.
Extraction quality varies by source — PMC NXML preserves structure
cleanly, OA-HTML may include some navigation residue, and OA-PDF can
have broken hyphenation. The publisher copy
(via DOI)
is the canonical version.