Identification and expression characterization of a WRKY transcription factor affecting squalene synthesis in Camellia oleifera

preprint OA: closed
Full text JSON View at publisher
Full text 99,317 characters · extracted from preprint-html · click to expand
Identification and expression characterization of a WRKY transcription factor affecting squalene synthesis in Camellia oleifera | Research Square window.SnipcartSettings = { analytics: { enabled: false } }; (function() { var accessVector = localStorage.getItem('access_vector') || ''; window.dataLayer = window.dataLayer || []; if (accessVector) { window.dataLayer.push({ user: { profile: { profileInfo: { snid: accessVector } } } }); } })(); (function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0],j=d.createElement(s),dl=l!='dataLayer'?'&l='+l:'';j.async=true;j.src='https://www.googletagmanager.com/gtm.js?id='+i+dl;f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-K279D39R'); Browse Preprints In Review Journals COVID-19 Preprints AJE Video Bytes Research Tools Research Promotion AJE Professional Editing AJE Rubriq About Preprint Platform In Review Editorial Policies Our Team Advisory Board Help Center Sign In Submit a Preprint Cite Share Download PDF Research Article Identification and expression characterization of a WRKY transcription factor affecting squalene synthesis in Camellia oleifera Qinhui Du, Luyao Ge, YanLing Zeng, Aori Li, Ziyan Zhu, Xiaofeng Tan This is a preprint; it has not been peer reviewed by a journal. https://doi.org/ 10.21203/rs.3.rs-4204992/v1 This work is licensed under a CC BY 4.0 License Status: Posted Version 1 posted You are reading this latest preprint version Abstract WRKY-like transcriptional regulators are widely involved in physiological processes such as growth and development, metabolic regulation and environmental response. In this study, we obtained six CoWRKY transcription factors by yeast one-hybrid screening library with reference to the Camellia oleifera genome sequence, using squalene synthase gene (CoSQS) as bait. AOS (Antibody Optimization System) analysis showed that CoWRKY15 had the highest interactions with a confidence level of 0.9026. Bioinformatics analysis showed that CoWRKY15 encodes 346 amino acid residues, was a basic hydrophilic protein, did not contain a transmembrane region, contained one WRKY conserved structural domain and one C2H2 zinc finger structural domain. and belonged to class 2 of the WRKY gene family, and had the closest genetic distance of 0.5564 to the homologous protein of Panax quinquefolius PqWRKY1. The results of prokaryotic expression showed that the CoWRK15 protein with a size of 38.3 kD was successfully induced by adding a final concentration of 0.5 mM ITPG for 4 h at 37℃. The results of subcellular localization showed that CoWRKY15 functioned in the nucleus. The results of CoWRKY15 promoter analysis showed that 8 out of 14 cis-elements with annotatable functions were related to the light response, indicating that the expression of CoWRKY15 was strongly affected by light. The correlation analysis of CoWRKY15 expression and squalene content in Camellia oleifera seed kernels treated under different light quality conditions showed a significant positive correlation. Camellia oleifera Squalene CoWRKY transcription factor expression Figures Figure 1 Figure 2 Figure 3 Figure 4 Figure 5 Figure 6 Figure 7 Figure 8 1. Introduction Camellia oleifera (Oil Tea), in a broad sense, refers to more than 60 shrubs of the genus Camellia (Theaceae) whose seed kernels produce high-quality edible oils [ 1 ] . Camellia oil is not only rich in unsaturated fatty acids, but also rich in squalene and other bioactive substances [ 2 ] . Squalene is an open-chain triterpene organic substance. Squalene is involved in tumour suppression and immune enhancement, has antibacterial and antiviral activity and can be used as a drug carrier and adjuvant for vaccines [ 3 ] . Although some studies have shown that C.oleifera seed kernels are rich in squalene, the mechanism involved is not clear. Kim et al [ 4 ] . proved that squalene synthase (SQS) regulation is the key factor affecting squalene accumulationas assessed through the SQS deletion yeast erg9 mutant functional complementarity test [ 5 ] . However, under the same promoter, the ability of SQS mutant to resume squalene synthesis was significantly different after the complementary expression, which indicated the importance of transcription factors. WRKY belongs to the WRKY-GCM1 zinc finger transcription factor superfamily, which is involved in plant growth, development, and physiological responses [ 6 , 7 ] . WRKY proteins in the plant kingdom form a large family of transcription factors that can be divided into at least three groups(GroupⅠ,GroupⅡ, and GroupⅢ) according to the characteristics of the structural domain [ 8 ] .The members of the WRKY family GroupⅠ contains two WRKYGQK domains, and the zinc fingerprint pattern is C-X4-5-C-X22-23H-X-H, such as AtWRKY33 in Arabidopsis thaliana [ 9 ] . The members of the WRKY family GroupⅡ contains only one WRKYGQK domain, and the zinc fingerprint pattern is the same as that of the first category, such as GmWRYK13 [ 10 ] in soybean. The members of the WRKY family Group Ⅲ contains only one WRKYGQK domain, but the zinc fingerprint is the same. The structural amino acids changed to C-X7-C-X22-23-H-X-C, such as JrWRKY4 [ 11 ] of walnuts . Yongzhen Sun [ 12 ] showed that the expression levels of HMGR, FPS2, SQS1, and SQE2 were higher than those of the control group after transformation of PqWRKY1 gene from P. quinquefolius into Arabidopsis thaliana . WRKY binds to the W-box in the promoter region of key genes involved in triterpenoid synthesis in Arabidopsis thaliana and PqWRKY1 was characterised by structural domains typical of WRKY family class 2 members. Our group compared the changes of squalene content in C.oleifera seed kernels during different developmental periods, constructed the transcriptome database, and based on the analysis that the CoSQS promoter contains a W-box cis-element, and retrieved the CoWRKY1 gene in the transcriptome database, which may interoperate with CoSQS, for yeast one-hybrid validation, we preliminarily demonstrated that squalene synthesis in C.oleifera seed kernels is affected by the CoWRKY transcription factor. However, the CoWRKY transcription factor is a large gene family [ 13 ] , and it is not clear whether there are other members that also combine with CoSQS to affect squalene synthesis in C.oleifera seed kernels. In this study, we combined C.oleifera genomic data, constructed C.oleifera seed kernel yeast libraries, used the CoSQS promoter as bait to regulate transcription factors that may interact with each other, and through AOS (Antibody Optimization System) analysis, identified the CoWRKY transcription gene CoWRKY15 with the highest interaction confidence, based on which we carried out bioinformatics analyses, prokaryotic expression and subcellular localization, and clarified the exogenous factor that most affects the expression of the CoWRKY genes through analysing their promoter sequences. By analysing its promoter sequence, the exogenous factor that most affects the expression of CoWRKY gene was clarified, and the squalene content was associated with the regulation of the expression of this CoWRKY through this exogenous factor, which further proved the role of CoWRKY transcription factor in affecting the squalene content of C.oleifera seed kernel, and provided scientific basis for revealing the function of WRKY transcription factor in C.oleifera seed kernel, and regulating the biosynthesis of squalene in plants by means of genetic engineering. 2. Materials and Methods 2.1 Plant materials In the gene cloning experiment, the seed kernels of national certified cultivar 'HS' were collected from the base of C.oleifera in Dongcheng, Hunan, Wangcheng County, Changsha Province. The fluorescent quantitative test materials were C.oleifera fruit under different light exposure conditions (Fig. 1 ) . Light not only affected the growth of C.oleifera , but also had an impact on the metabolism of squalene [ 14 , 15 ] . Light exposure treatments included blue light (B), white light (W), red light (R), a red–blue light combination (RB; red–blue ratio: 1:1), and sunlight (CK). LED lights were used as light sources for treatment except for CK, including blue (450–480 nm), red (610–640 nm), and white (420–720 nm) LED lights. Spectral characteristics of the different light quality treatments were measured with a HopooColor OHSP-350SF Spectral Color Luminance Meter (HopooColor, Hangzhou, China). The light source was placed above the three year-old C.oleifera , and the height of the LED light source was adjusted to ensure that the photon flux density (PPFD) of each treated plant canopy is 200 ± 10 µmol·m-2s-1 (Fig. 1 ) 2.2 Real-Time PCR Quantification of Gene Expression The relative expression of CoWRKY15 gene was analysed by real-time PCR using the cDNA of the test material as template, and CoEF1α gene was used as the internal reference gene, and three parallel replicates of the assay were done for each sample. The PCR primers for CoWRKY and CoEF1αF/CoEF1αR were F 5′- CTTTCGTCGTTGTCGGCGTTTC-3′, R 5 ′- ACAATGGCAGCGGTCGGAAG-3′, F 5′- CAAAGAAGGGTGCCAAGTGA − 3′ and R 5′- ACCAAACAACCGACCTACGA − 3′, respectively. The PCR reaction system was: 2 × ChamQSYBR qPCR Master The PCR reaction system was as follows: 2 × ChamQSYBR qPCR Master MixMix 10.0 µL, forward and reverse primers (10 Pmol.L-1) 0.4 µL each, 50 × ROX Reference Dye1 0.4 µL, cDNA 0.5 µL, and ultrapure water 8.3 µL. The PCR amplification conditions were as follows: 95 ℃ pre-denaturation for 30 sec, 95 ℃ denaturation for 10 sec, and 60 ℃ annealing for 30 sec for a total of 40 cycles; dissolution curve 95 ℃ denaturation for 30 sec, and dissolution curve 95 ℃ denaturation for 30 sec for 40 cycles. 2.3 Yeast one-hybrid screening RNA was extracted from Camellia oleifera using the Trizol method using (reverse transcription-polymerasechain reaction, RT-PCR) to obtain cDNA, the reaction system are: 2 µL of 5× PrimeScriptRT Mix, 2 µg of Total RNA, RNase Free ddH 2 O to 10 µl. The reaction conditions were as follows: 25°C, 10 min; 42 ℃, 30 min; 85 ℃, 5min; 4℃, 3min. After purification, it was homologously recombined with linear pGADT7 and transformed into Escherichia coli to construct the C.oleifera kernels cDNA library. The 1600bp upstream sequence of the C.oleifera squalene synthase gene ( CoSQS ) promoter was indroduced into pHIS2 and transformed into Y187 strain for background screening (Fig. 2 ), to determine the subsequent screening concentration using 75mM 3AT. The primers used for plasmid construction were pHIS2-CoSQS F: 5'-TACGACTCACTATAGGGCGAATTCGTTATGTTAG-3' and pHIS2-CoSQS R: 5 '-ATCGATTCGCGAACGCGTGAGCTCTTTTCTCTCT-3'. Using Y187 yeast containing the correct pHIS2-CoSQS- promoter bait plasmid as the receptor strain to prepare the competent cell, the cDNA library plasmid was transferred into it and 100 µL was applied to SD-LTH/75 mmol/L 3-AT culture Nutrient-based plates were incubated inversion at 30°C for 4–6 days. The positive transformants grown on the SD-TLH + 75 mM 3AT screening plate were scraped and subjected to NGS screening and sequencing. 2.4 Prokaryotic expression Using the C.oleifer cDNA of the test material as template, pET32a-CoWRKY15F 5'-GCCATGGCTGATATCGGATCCATGATGGCCGTCGAGCTCGTGATG-3' and pET32a-CoWRKY15R: 5 '- CTCGAGTGCGGCCGCAAGCTTTCAAGAAGACTCTAAGATAAG-3' as primers, the products obtained from PCR amplification were recovered and used in the ClonExpress II One Step Cloning Kit (Vazyme) to pET32a using homologous recombination. The 10 µL reaction system was: 5×CEIIBuffer 2.0 µL, Exuase II 1.0 µL, recovered product (20–100 ng) 2.0 µL, linearized vector 4.0 µL, and PCR-Grade Water 1.0 µL. The reaction conditions were: 37 ℃ for 30 min; 4 ℃ for 5 min. Single colonies of positive and transformed empty carriers were selected and cultured 3 mL liquid LB medium containing ampicillin for 12 h at 37°C. Subsequently, the culture was expanded in 200 mL with 1% inoculum and induced with 0.5 mM IPTG at OD600 = 0.8, followed by culture at 37℃ for 4 h. Then, the cell pellet was obtained by centrifugation for 2 min at 8000rpm and resuspended in an appropriate volume of Laemmli buffer, denatured at 100°C for 10 min, and subjected to SDS-PAGE. 2.5 subcellular localization Using the C.oleifer cDNA of the test material as template, pCAMBIA1300-CoWRKY15F: 5'- gatcaagagacaggatccgATGATGGCCGTCGAGCTCGTGATG-3' and pCAMBIA1300-CoWRKY15R: 5'-tcaccatcggtgcactagtgTCAAGAAGACTCTAAGATAAG-3' as primers, the products obtained from PCR amplification were recovered and used in the ClonExpress II One Step Cloning Kit (Vazyme) to pCAMBIA1300 using homologous recombination. Choose Nicotiana benthamiana leaves that are suitable for healthy, referring the live infection method of Agrobacterium tumefaciens by Zeng Yanling et al [ 16 ] . Agrobacterium tumefaciens containing recombinant plasmids were injected into N. benthamiana leaves. The leaves were cultivated for 48 hours, and observed the fluorescence signal of eGFP under a laser confocal microscope excitation wavelength of 488 nm [ 17 ] . 2.6 Squalene content analysis Camella oil was extracted using Soxhlet extraction method [ 18 ] . Liquid chromatography (HPLC) was used to determine the squalene content in Camellia oil. The detection conditions were as follows: Agilent reverse C18 column, mobile phase (methanol: acetonitrile = 35:65), sample injection volume of 20 µL, flow rate of 1 mL/min, column temperature of 40 ℃, and detection wavelength of 210 nm. 2.7 Data Analysis Interaction prediction was performed using AOS (Antibody Optimisation System), a software developed by Pronetbio Co [ 19 ] . The physical and chemical properties and structural characteristics of CoWRKY15 were predicted by on-line software ProtParam ( https://web.expasy.org/protparam ) and TMHMM ( https://services.healthtech.dtu.dk/services/TMHMM-2.0 ). CoWRKY15 promoter cis-acting elements were predicted by PLACE ( https://www.dna.affrc.go.jp/PLACE/?action=newplace ). The phylogenetic tree was constructed and the cluster relationship was analyzed by using offline software MEGA11 [ 20 ] . Fluorescence quantitative PCR(real-time PCR)data were analyzed by Bio-Rad CFX Manager software. The correlation was analyzed by SPSS Statistics22.0 software. 3. Results 3.1 Obtaining WRKY transcription factors based on the CoSQS promoter yeast one-hybrid screen library As the transcription factors of endogenous yeast may cause histidine excretion leakage, so it is necessary to add 3-AT to inhibit this leakage, in amino acids Auxotrophic medium SD-LTH was supplemented with 0, 5, 10, 20, 30, 40, 50, 75, 100mM, respectively mmol/L of 3-AT, which is determined by observing yeast growth Appropriate 3-AT inhibitory concentrations. When the concentration of 3-AT is increased to 75 mmol/L, Yeast in the test group and negative control the growth of the cells is completely inhibited, The positive control grew normally, The results indicated that pHIS2-CoSQS did not occur in yeast AH109 activation, Therefore, 75 mmol/L 3-AT can be used as the lowest inhibitory concentration yeast single bulk library screening was performed. Based on the CoSQS promoter yeast single heterozygous screening library, a total of 1632 NGS sequences were obtained, which were related to 43 metabolic pathways such as signal transduction, environmental adaptation, fatty acid synthesis, and triterpenoid skeleton synthesis, including 379 transcription factors and 394 kinases (Fig. 3 a). AOS analysis revealed 6 CoWRKY transcription factors interacting with CoSQS promoter that the CoWRKY transcription factor with the highest similarity to Camellia sinensis WRKY15 [ 21 ] (GenBank number: XM_028196157) had the highest confidence in interacting with the CoSQS promoter sequence, which was 0.9026. The predicted results of both indicate 14 binding sites (Fig. 3 b-e). 3.2 Bioinformatics analysis of CoWRKY15 The physical and chemical properties of CoWRKY15 were analyzed using on-line and off-line bioinformatics software. The results showed that the gene encoded 346 amino acids, the theoretical molecular weight (Mw) was 38297.31 Da, and the isoelectric point (pI) was 9.60, indicating that the protein was alkaline under physiological conditions. The number of negatively charged residues (Asp + Glu) was 33, the number of positively charged residues (Asp + Lys) is 49, and the molecular formula was C 1639 H 2674 N 508 O 518 S 16 . The instability index (II) is 52.84 for the typical unstable protein. The total average hydrophobicity (GRAVY) of the protein was − 0.616, which was predicted hydrophilicity. ProtParam predicted that 9.83% of CoWRKY15 protein was α-helical structure, 11.27% was β-folded, and 78.90% was irregularly coiled with no signal peptide. CoWRKY15 was predicted to function in eukaryotic nuclei with a confidence level of 43. TMHMM predicted the absence of a transmembrane region for the CoWRKY15 protein (Fig. 4 a). The hydrophilic index of CoWRKY15 protein ranged from − 3.356 to 1.700, in which hydrophobic residues accounted for 67.34% of the entire amino acid residues, which was typical of hydrophobic proteins (Fig. 4 b). The CoWRKY15 protein existed at one functional site, the WRKY structural domain, located at positions 268–334 Aa, with the amino acid sequence "KMSDIPPDDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPKMLIVTYEGEHNHSLS ". Judging from the conserved amino acid sequences contained and the structural features of the zinc finger, CoWRKY15 belonged to class 2 members of the WRKY family. 3.3 Phylogenetic tree analysis Based on previous studies [ 22 , 23 ] and the results of BLAST on http://www.ncbi.nlm.nih.gov website, 19 plant WRKY amino acid sequences and CoWRKY15 amino acid sequences were selected for cluster analysis. The results showed that the genetic distance ranged from 0.0063 to 1.7279. CoWRKY15 had a genetic distance of 0.5564 with PqWRKY1 of P. quinquefolius , thereby exhibiting a close genetic association. The genetic distance between CoWRKY15and AtWRKY2 homologous proteins of Arabidopsis thaliana was 1.5746 with the farthest genetic correlation (Fig. 5 a). This phenomenon indicated that the WRKY gene family altered greatly during evolution. The conserved domain of the WRKY protein, was analyzed, and the AtWRKY66 of A.thaliana was found to belong to type Ⅲ of the WRKY family. It contains only one WRKYGQK domain and has a typical zinc fingerprint of C-X7-C-X22-23-H-X-C. The AtWRKY26, AtWRKY33, and AtWRKY2 of A.thaliana belonged to type Ⅰof the WRKY family and contain two WRKYGQK domains. The zinc fingerprinting pattern was C-X4-5-C-X22-23H-X-H. The other members belonged to typeⅡof the WRKY family with only one WRKYGQK domain (Fig. 5 b). The zinc fingerprinting pattern was C-X4-5-C-X22-23H-X-H. CoWRKY15 of C.oleifera belonged to typeⅡof the WRKY family ascribed to the typical characteristics of typeⅡmembers. However, the genetic distances with AtWRKY26, AtWRKY33, and AtWRKY2 of typeⅠmembers were closer than those of AtWRKY40, AtWRKY18, and AtWRKY60 of typeⅡmembers. This phenomenon might be attributed to the fact that the first type members of the WRKY family constituted the branch of origin, that differentiated into several subclasses in order to adapt to the environment. Thus, the genetic distance between different subclasses becomed longer. 3.4 Analysis of CoWRKY15 expression in prokaryotes The recombinant plasmid pET32a- CoWRKY15 and empty plasmid pET32a were transformed into E. coli Rosseta (DE3), respectively. The expression of CoWRKY15 in E. coli was analyzed by SDS-PAGE after IPTG induction. ProtParam, an online software, demonstrated that CoWRKY15 gene was expressed at about 38.2 kDa. The protein expressed as a His-tag sequence at N-terminal of the expression system also induced to express about 23.8 kDa, such that the expected expression level of the fusion protein was about 60 kDa. SDS-PAGE displayed a fusion protein band of about 60 kDa, while only the labeled protein band was induced in the empty plasmid strains, and no specific protein band was detected in the non-induced transformed recombinant plasmid strains (Fig. 6 ). The recombinant plasmid pET32a- CoWRKY15 was successfully induced to express the CoWRKY15 protein in E. coli . 3.5 CoWRKY15 subcellular localization The fusion expression vector was transformed into tobacco leaves by the tobacco injection method, and CoWRKY15 was efficiently transiently expressed in the vicinity of the injected area after 48 h of incubation. eGFP fluorescence signals in tobacco leaves were observed under a confocal laser microscope, and the results showed that eGFP fluorescence signals completely overlapped with autofluorescence signals of the nucleus under the excitation of 543 nm light (Fig. 7 ), which indicated that CoWRKY15 might be located in the nucleus, which is in agreement with the results of the bioinformatics analyses. 3.6 Analysis of Cis-Acting Elements in the CoWRKY15 Promoter Plant Care, an online promoter analysis database, analyzed the 2000 bp sequence of the upstream non-coding region of CoWRKY15 for cis-elements (Table 1 ), which showed that the sequence contained 14 types of cis-acting elements with annotated functions, including eight elements involved in the light response (AE-box, AT1-motif, Box 4, G-box, L-box, LAMP-element, Sp1, Chs-CMA2a), one cis-acting element involved in abscisic acid response (ABRE), and two methyl jasmonate-responsive elements (CGTCA-motif, TGACG-motif). These results suggested that CoWRKY15 gene expression might be regulated by photosystems and hormone-like signaling substances. Table 1 Prediction of cis-acting elements in the CoWRKY15 promoter. cis-regulatory element core sequence Position and Strand function A-box CCGTCC 9(-)/679(+) Cis-acting regulatory element ABRE ACGTG 235(+) Cis-acting elements involved in the abscisic acid responsiveness AE-box AGAAACAA 1146(-) Part of a module for light respone ARE AAACCA 1524(-) Cis-acting regulatory element essential for the anaerobic induction AT-rich element ATAGAAATCAA 899(-)/1284(+) Binding site of AT-rich DNA binding protein (ATBP-1) AT1-motif AATTATTTTTTATT 1796(-) Part of a light responsive module Box4 ATTAAT 288(+)/1807(-)/1476(-) 968(+)/1618(-) Part of a conserved DNAmodule involved in light responsiveness CGTCA-motif CGTCA 1308(-) cis-acting regulatory element involved in the MeJA-responsiveness G-box TACGTG 234(+) cis-acting regulatory element involved in light responsiveness L-box ATCCCACCTAC 707(+) Part of a light responsive element LAMP-element CTTTATCA 143(-) Part of a light responsive element Sp1 GGGCGG 728(-)/1657(-)/774(-) Light responsive element TGACG-motif TGACG 1308(+) cis-acting regulatory element involved in the MeJA-responsiveness Chs-CMA2a TCACTTGA 1099(-) Part of a light responsive element 3.7 Effect of CoWRKY15 expression on squalene content under different light qualities he CoWRKY15 promoter sequence contained at least eight light-responsive elements (Table 1 ). Significant differences in the CoWRKY15 expression and squalene content were observed after different light quality treatments (Fig. 6 ), and bivariate correlation analysis of the two parameters yielded a Pearson correlation of 0.798 and a significance of 0.106. 4. Discussion Camellia oleifera is rich in squalene, that is a pivotal product of the terpene metabolic pathway. Some studies have shown that the key enzyme gene affecting squalene synthesis is SQS [ 24 ] . A previous study by our group found that the expression of CoSQS was regulated by the transcription factor WRKY [ 25 ] . WRKY is a transcriptional regulator occurring widely throughout the plant kingdom. It participates in regulating the biological and abiotic stresses and physiological responses of various metabolic pathways and is closely related to plant growth, development, and senescence [ 26 , 27 ] . WRKY TFs can specifically recognize the W-box, with sequence TTGAC/T within the target genes’ promoter regions [ 28 ] . Hanting Yang [ 29 ] also found that WRKY functions as a transcriptional regulator of plant secondary metabolite synthesis. In this study, we used bioinformatics to analyze six WRKY transcription factors that might interact with CoSQS , among which the CoWRKY15 transcription factor, which had the highest confidence of interaction, was not the same as the CoWRKY1 transcription factor that was obtained by our group based on transcriptome analysis in the previous stage. Multiple WRKY transcription factors that might affect terpenoid metabolism had also been found in Panax ginseng [ 30 ] . The synthesis of terpenoid metabolites could be induced by herbivory, wounding, light, low temperatures, and other stress conditions [ 31 ] . It was possible that the WRKY transcription factors that bind to the CoSQS promoter were not the same under different conditions, leading to differences in the outcome of transcriptional regulation, which ultimately exhibited differences in squalene content. According to the number of WRKY domains and the characteristics of a zinc finger structure, WRKY could be divided into Groups I, II, and III. Group II can be further divided into five sub-categories: IIa, IIb, IIc, IId, and IIe [ 32 ] . The deduced amino acid sequence of CoWRKY15 gene of C.oleifera consisted of a typical WRKY domain and C2H2zinc finger structure, categorized into the second group of WRKY members. CoWRKY15 is genetically most distant from PqWRKY1, which was the 1st transcription factor gene cloned and identified in P.quinquefolius that might be involved in the regulation of triterpenoid saponin synthesis, and could regulate squalene synthesis in combination with the W-box structural domain of the promoter region of the SQS gene [ 33 ] . CoWRKY15 and PqWRKY1 were clustered together and had similar structural characteristics, further indicating that CoWRKY15 had the function of transcriptional regulation of squalene synthesis in C.oleifera . UV-B treatment of one-year-old potted C. sinensis cv. Longjing-43 differentially altered the metabolism of terpenoids with significant effects after 8 h of treatment, demonstrating the strong potential of UV-B application for flavor improvement in tea [ 34 ] . This study used different wavelengths light to treat reproductive period C.oleifera , and the results showed that different wavelengths light also had a significant impact on the content of squalene in C.oleifera kernels. The correlation analysis between squalene content in C. oleifera seeds and CoW RKY15 expression under different light quality conditions showed a positive correlation between the two, but the correlation did not reach a very significant level. This may be because CoSQS directly regulated the synthesis of squalene, while CoWRKY15 affected the squalene content in C. oleifera kernels by regulating the expression of CoSQS. In addition, bioinformatics software predicts that CoWRKY15 was a hydrophilic non transmembrane 38.2 kD protein located in the nucleus. This study confirmed the predicted results through prokaryotic expression and subcellular localization methods. CoWRKY15 was localized in the nucleus consistent with a location where transcription factors played a role. This study analyzed the effect of CoWRKY15 transcription factor on the accumulation of squalene in C. oleifera seeds through multiple pathways. However, whether there are other members of the CoWRKY family interacting with CoSQS , and what factors affect interaction selection still need to explored. 5.Conclusion CoWRKY transcription factors were present in C.oleifera seed kernel in the form of a multigene family, among which CoWRKY15 interacts with CoSQS with the highest predicted confidence.CoWRKY15 belonged to the second class of members in the WRKY family, encoding 346 aa, which was a hydrophilic protein without transmembrane structure of about 38.2 kD in size, and it functioned in the nucleus. The wavelength of light had a significant effect on the squalene content of C.oleifera seed kernels, and CoWRKY15 transcription factor positively regulated the squalene content of C.oleifera seed kernels under this condition. Declarations Author Contributions: Y.Z. conceived and designed the experiments; Q.D., L.G., A. L. and Z.Z. performed the experiment, data collection, lab analysis, and data analysis. Q.D and L.G. wrote the paper; Y.Z. edited the paper. All authors have read and agreed to the published version of the manuscript. Funding: This work was supported by the Major Program of Natural Science Foundation of Hunan Province (2021JC0007), the Natural Science Foundation of Hunan Province (2022JJ30998), and the Fundamental Research Funds of Forestry Department of Hunan Province (XLKY202221). Data Availability Statement: Data are contained within the article. Conflicts of Interest: The authors declare no conflict of interest. Ethics approval and consent to participate: Not applicable. References LIN P, WANG K, WANG Y, et al. The genome of oil-Camellia and population genomics analysis provide insights into seed oil domestication [J]. Genome biology, 2022, 23(1): 14. HAO L I, XUE-ZHI F, HAI-YAN Z, et al. Variation of Physicochemical Properties and Nutritional Components of Oil-tea Camellia Seeds during Riping [J]. Forest Research, 2014, 27(1): 86-91. TATENO M, STONE B J, SRODULSKI S J, et al. Synthetic Biology-derived triterpenes as efficacious immunomodulating adjuvants [J]. Scientific Reports, 2020, 10(1): 17090. KIM T D, HAN J Y, HUH G H, et al. Expression and Functional Characterization of Three Squalene Synthase Genes Associated with Saponin Biosynthesis in Panax ginseng [J]. Plant and Cell Physiology, 2011, 52(1): 125-37. BRAMLEY P M, ELMADFA I, KAFATOS A, et al. Vitamin E (p 913-938) [J]. journal of the science of food\&\agriculture, 2010, 80(7). BAKSHI M, OELMüLLER R. WRKY transcription factors [J]. Plant Signaling & Behavior, 2014. FENG W, XIAO-ZHU W U, LIANG L, et al. Research advances on physiological function of WRKY transcription factor in plant stress resistance [J]. Guihaia, 2017. RUSHTON P J, SOMSSICH I E, RINGLER P, et al. WRKY transcription factors [J]. Trends in Plant Science, 2010, 15(5): 247-58. ABUQAMAR S, CHEN X, DHAWAN R, et al. Expression profiling and mutant analysis reveals complex regulatory networks involved in Arabidopsis response to Botrytis infection [J]. The Plant Journal, 2006, 48(1): 28-44. ZHOU Q Y, TIAN A G, ZOU H F, et al. Soybean WRKY-type transcription factor genes, GmWRKY13, GmWRKY21, and GmWRKY54, confer differential tolerance to abiotic stresses in transgenic Arabidopsis plants [J]. Plant Biotechnology Journal, 2008, 6(5): 486-503. LI X U, XIN C, HAI-RONG W, et al. Cloning and Expression Analysis of WRKY4 Gene from Juglans regia L [J]. Journal of Nuclear Agricultural Sciences, 2014, 28(7): 1188-96. HARA M, FURUKAWA J, SATO A, et al. Abiotic Stress and Role of Salicylic Acid in Plants [J]. Springer New York, 2012. MUHAMMAD, WAQAS, MUHAMMAD, et al. Genome-wide identification and expression analyses of WRKY transcription factor family members from chickpea (Cicer arietinum L.) reveal their role in abiotic stress-responses [J]. Genes & Genomics, 2019. BELéN, GONZáLEZ, AMORóS, et al. A model study into the effects of light and temperature on the degradation of fingerprint constituents [J]. Science & Justice, 2014. HE C, ZENG Y, FU Y, et al. Light quality affects the proliferation of in vitro cultured plantlets of Camellia oleifera Huajin [J]. PeerJ, 2020, 8(3): e10016. YAN-LING Z, DANG-QUAN Z, XIAO-FENG Z, et al. Molecular Characterization and Expression Analysis of Squalene Synthetase Gene( CoSQS) from Camellia oleifera [J]. Journal of Plant Genetic Resources, 2016. HIEI Y. Efficient transformation of rice (Oryza sativa L.) mediated by Agrobacterium and sequence analysis of the boundaries of the T-DNA [J]. Plant J, 1994, 6. YANG H, BI W Y, CHEN H X, et al. Contrastive Studies of Coal between Direct Ultrasonic Extraction and Soxhlet Extraction [J]. Advanced Materials Research, 2011, 236-238. OHUE M, SHIMODA T, SUZUKI S, et al. MEGADOCK 4.0: an ultra–high-performance protein–protein docking software for heterogeneous supercomputers [J]. Bioinformatics, 2014, 30(22). KOICHIRO T, GLEN S, SUDHIR K. MEGA11: Molecular Evolutionary Genetics Analysis Version 11 [J]. Molecular Biology and Evolution, (7): 7. EN-HUA, HAI-BIN, ZHANG, et al. The Tea Tree Genome Provides Insights into Tea Flavor and Independent Evolution of Caffeine Biosynthesis [J]. 分子植物:英文版, 2017, (6): 866-77. REN X, CHEN Z, LIU Y, et al. ABO3, a WRKY transcription factor, mediates plant responses to abscisic acid and drought tolerance in Arabidopsis [J]. The Plant Journal, 2010. WENBO, JIANGDIQIU, YU. Arabidopsis WRKY2 transcription factor mediates seed germination and postgermination arrest of development by abscisic acid [J]. Bmc Plant Biology, 2009. SUO J, TONG K, WU J, et al. Comparative transcriptome analysis reveals key genes in the regulation of squalene and β-sitosterol biosynthesis in Torreya grandis [J]. Industrial Crops and Products, 2019, 131: 182-93. YANG R, YAN Y, ZENG Y, et al. Correlation between squalene synthase promoter and WRKY transcription factor in Camellia oleifera [J]. Journal of Horticultural Science and Biotechnology, 2020: 1-10. LAGACé M, MATTON D P. Characterization of a WRKY transcription factor expressed in late torpedo-stage embryos of Solanum chacoense [J]. Planta, 2004, 219(1): 185-9. XU X, CHEN C, CHEN F Z. Physical and Functional Interactions between Pathogen-Induced Arabidopsis WRKY18, WRKY40, and WRKY60 Transcription Factors [J]. Plant Cell, 2006, 18(5): 1310-26. CIOLKOWSKI I, WANKE D, BIRKENBIHL R P, et al. Studies on DNA-binding selectivity of WRKY transcription factors lend structural clues into WRKY-domain function [J]. Plant Molecular Biology, 2008, 68(1-2): 81-92. YANG H, LI H, LI Q. Biosynthetic regulatory network of flavonoid metabolites in stems and leaves of [J]. Scientific Reports. DI P, WANG P, YAN M, et al. Genome-wide characterization and analysis of WRKY transcription factors in Panax ginseng [J]. BMC Genomics, 2021, (1). WEN B, LUO Y, LIU D, et al. The R2R3-MYB transcription factor CsMYB73 negatively regulates L-Theanine biosynthesis in tea plants (Camellia sinensis L.) [J]. Plant Science: An International Journal of Experimental Plant Biology, 2020, (298-): 298. LEI L, BINGYAN X, XIAOFENG D, et al. WRKY Transcription Factors and Their Roles in Plant Defense Responses [J]. Molecular Plant Breeding, 2005, 3: 401-8. ZENG, GUO, LP, et al. Arbuscular mycorrhizal symbiosis and active ingredients of medicinal plants: current research status and prospectives [J]. MYCORRHIZA, 2013, 2013,23(4)(-): 253-65. SHAMALA L, ZHOU H, HAN Z, et al. UV-B Induces Distinct Transcriptional Re-programing in UVR8-Signal Transduction, Flavonoid, and Terpenoids Pathways inCamellia sinensis [J]. Frontiers in plant science, 2020, 11: 234. Additional Declarations No competing interests reported. Cite Share Download PDF Status: Posted Version 1 posted You are reading this latest preprint version Research Square lets you share your work early, gain feedback from the community, and start making changes to your manuscript prior to peer review in a journal. As a division of Research Square Company, we’re committed to making research communication faster, fairer, and more useful. We do this by developing innovative software and high quality services for the global research community. Our growing team is made up of researchers and industry professionals working together to solve the most critical problems facing scientific publishing. Also discoverable on Platform About Our Team In Review Editorial Policies Advisory Board Help Center Resources Author Services Accessibility API Access RSS feed Manage Cookie Preferences © Research Square 2026 | ISSN 2693-5015 (online) Privacy Policy Terms of Service Do Not Sell My Personal Information {"props":{"pageProps":{"initialData":{"identity":"rs-4204992","acceptedTermsAndConditions":true,"allowDirectSubmit":true,"archivedVersions":[],"articleType":"Research Article","associatedPublications":[],"authors":[{"id":287429915,"identity":"4be048d1-9286-4fa6-88fd-a8fc1f1af6b0","order_by":0,"name":"Qinhui Du","email":"","orcid":"","institution":"Central South University of Forestry and Technology","correspondingAuthor":false,"prefix":"","firstName":"Qinhui","middleName":"","lastName":"Du","suffix":""},{"id":287429916,"identity":"1c882286-ad12-4e1a-8586-11cd135d6efc","order_by":1,"name":"Luyao Ge","email":"","orcid":"","institution":"Central South University of Forestry and Technology","correspondingAuthor":false,"prefix":"","firstName":"Luyao","middleName":"","lastName":"Ge","suffix":""},{"id":287429917,"identity":"1dc2fff2-35fe-4cf8-b940-56f9885cae71","order_by":2,"name":"YanLing Zeng","email":"data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAZAAAAAyAQMAAABI0h/eAAAABlBMVEX///8AAABVwtN+AAAACXBIWXMAAA7EAAAOxAGVKw4bAAAA/ElEQVRIiWNgGAWjYBADGTYgcSDBwIaHn72BOC08QC2MBx5UpMlI9hwgUgsQMx98cOawjcENB/xK5dt7D7/mqbnDwyfdfuFAYtt5HoYbDIwfPubg1sLYcy7NmufYMx42mTMFQC23eRhnNzBLztyGWwuzRI6ZMQ/bYR42iZwEsBZmmQNszLx4tLDJvwFq+QfXcg7ISMCvhUeCx/gxbxtIS/qBAwlnDvDwENIiwZNjxji3D2wLMF4qkoFmHGzG6xf59jPGH958OywnPyP98ccfBnb29sebD374iEcLyDtSPBA3GkAFGBvwqgcC5o8/wDT7A0IqR8EoGAWjYIQCADybUnE29JEpAAAAAElFTkSuQmCC","orcid":"","institution":"Central South University of Forestry and Technology","correspondingAuthor":true,"prefix":"","firstName":"YanLing","middleName":"","lastName":"Zeng","suffix":""},{"id":287429918,"identity":"515f1337-35f4-409d-a6e1-606cfea9fa32","order_by":3,"name":"Aori Li","email":"","orcid":"","institution":"Central South University of Forestry and Technology","correspondingAuthor":false,"prefix":"","firstName":"Aori","middleName":"","lastName":"Li","suffix":""},{"id":287429920,"identity":"1162ab73-c17b-4828-a109-1debdd0bb67e","order_by":4,"name":"Ziyan Zhu","email":"","orcid":"","institution":"Central South University of Forestry and Technology","correspondingAuthor":false,"prefix":"","firstName":"Ziyan","middleName":"","lastName":"Zhu","suffix":""},{"id":287429924,"identity":"f60a4823-1b68-4f78-9b30-c5f67a2f8893","order_by":5,"name":"Xiaofeng Tan","email":"","orcid":"","institution":"Central South University of Forestry and Technology","correspondingAuthor":false,"prefix":"","firstName":"Xiaofeng","middleName":"","lastName":"Tan","suffix":""}],"badges":[],"createdAt":"2024-04-02 08:20:08","currentVersionCode":1,"declarations":"","doi":"10.21203/rs.3.rs-4204992/v1","doiUrl":"https://doi.org/10.21203/rs.3.rs-4204992/v1","draftVersion":[],"editorialEvents":[],"editorialNote":"","failedWorkflow":false,"files":[{"id":54343119,"identity":"03f63205-4ada-4c6e-942f-1880f59e7357","added_by":"auto","created_at":"2024-04-09 06:07:02","extension":"png","order_by":1,"title":"Figure 1","display":"","copyAsset":false,"role":"figure","size":1527056,"visible":true,"origin":"","legend":"\u003cp\u003eSee image above for figure legend\u003c/p\u003e","description":"","filename":"1.png","url":"https://assets-eu.researchsquare.com/files/rs-4204992/v1/b3d01b933225ef32e23aded1.png"},{"id":54343120,"identity":"639be829-ea82-43a9-a5a8-095b5d8f30a0","added_by":"auto","created_at":"2024-04-09 06:07:02","extension":"png","order_by":2,"title":"Figure 2","display":"","copyAsset":false,"role":"figure","size":862907,"visible":true,"origin":"","legend":"\u003cp\u003eBackground screening results\u003c/p\u003e","description":"","filename":"2.png","url":"https://assets-eu.researchsquare.com/files/rs-4204992/v1/ef244d15dd71306acc068d0f.png"},{"id":54343502,"identity":"6d01e3c3-0631-446b-8214-352ea8a9002e","added_by":"auto","created_at":"2024-04-09 06:15:02","extension":"png","order_by":3,"title":"Figure 3","display":"","copyAsset":false,"role":"figure","size":2226802,"visible":true,"origin":"","legend":"\u003cp\u003eSee image above for figure legend\u003c/p\u003e","description":"","filename":"3.png","url":"https://assets-eu.researchsquare.com/files/rs-4204992/v1/b58afc7508ff9398daab45b3.png"},{"id":54343122,"identity":"11ac7c13-225c-4dec-9a68-e328401e0600","added_by":"auto","created_at":"2024-04-09 06:07:02","extension":"png","order_by":4,"title":"Figure 4","display":"","copyAsset":false,"role":"figure","size":45356,"visible":true,"origin":"","legend":"\u003cp\u003eTransmembrane domain prediction and hydrophobicity prediction of CoWRKY15. (a) CoWRKY15 transmembrane prediction; (b) CoWRKY15 hydrophobicity prediction.\u003c/p\u003e","description":"","filename":"4.png","url":"https://assets-eu.researchsquare.com/files/rs-4204992/v1/419a9e4d191bf73d4958efe6.png"},{"id":54343124,"identity":"998aa941-8ac3-4198-a879-1c1be825696d","added_by":"auto","created_at":"2024-04-09 06:07:02","extension":"png","order_by":5,"title":"Figure 5","display":"","copyAsset":false,"role":"figure","size":1509366,"visible":true,"origin":"","legend":"\u003cp\u003eSee image above for figure legend\u003c/p\u003e","description":"","filename":"5.png","url":"https://assets-eu.researchsquare.com/files/rs-4204992/v1/c0b930fced4f0ca2172a39de.png"},{"id":54343125,"identity":"2f81c5f1-fd20-45ef-bfa6-605c51c379d8","added_by":"auto","created_at":"2024-04-09 06:07:02","extension":"png","order_by":6,"title":"Figure 6","display":"","copyAsset":false,"role":"figure","size":611608,"visible":true,"origin":"","legend":"\u003cp\u003eSee image above for figure legend\u003c/p\u003e","description":"","filename":"6.png","url":"https://assets-eu.researchsquare.com/files/rs-4204992/v1/5398ae77f4a9695e0ff40756.png"},{"id":54343127,"identity":"dca12d03-a935-4f67-bed9-909e8b4b21e6","added_by":"auto","created_at":"2024-04-09 06:07:03","extension":"png","order_by":7,"title":"Figure 7","display":"","copyAsset":false,"role":"figure","size":1659197,"visible":true,"origin":"","legend":"\u003cp\u003eSee image above for figure legend\u003c/p\u003e","description":"","filename":"7.png","url":"https://assets-eu.researchsquare.com/files/rs-4204992/v1/22e25e8582f70982e906d46b.png"},{"id":54343126,"identity":"88c4bb2f-38ce-4f91-aacd-c23562f63b19","added_by":"auto","created_at":"2024-04-09 06:07:03","extension":"png","order_by":8,"title":"Figure 8","display":"","copyAsset":false,"role":"figure","size":357683,"visible":true,"origin":"","legend":"\u003cp\u003eSee image above for figure legend\u003c/p\u003e","description":"","filename":"8.png","url":"https://assets-eu.researchsquare.com/files/rs-4204992/v1/2b2ebc4968a02b8f9e1a6476.png"},{"id":54378962,"identity":"2faaa8ad-77fb-4066-8f8d-cdc2fa1386f2","added_by":"auto","created_at":"2024-04-09 15:01:05","extension":"pdf","order_by":0,"title":"","display":"","copyAsset":false,"role":"manuscript-pdf","size":5733655,"visible":true,"origin":"","legend":"","description":"","filename":"manuscript.pdf","url":"https://assets-eu.researchsquare.com/files/rs-4204992/v1/5c14f3ef-dd3c-4243-8538-757f5ddad602.pdf"}],"financialInterests":"No competing interests reported.","formattedTitle":"Identification and expression characterization of a WRKY transcription factor affecting squalene synthesis in Camellia oleifera","fulltext":[{"header":"1. Introduction","content":"\u003cp\u003e\u003cdiv class=\"BlockQuote\"\u003e\u003cp\u003e\u003cem\u003eCamellia oleifera\u003c/em\u003e (Oil Tea), in a broad sense, refers to more than 60 shrubs of the genus \u003cem\u003eCamellia\u003c/em\u003e (Theaceae) whose seed kernels produce high-quality edible oils\u003csup\u003e[\u003cspan citationid=\"CR1\" class=\"CitationRef\"\u003e1\u003c/span\u003e]\u003c/sup\u003e. \u003cem\u003eCamellia\u003c/em\u003e oil is not only rich in unsaturated fatty acids, but also rich in squalene and other bioactive substances\u003csup\u003e[\u003cspan citationid=\"CR2\" class=\"CitationRef\"\u003e2\u003c/span\u003e]\u003c/sup\u003e. Squalene is an open-chain triterpene organic substance. Squalene is involved in tumour suppression and immune enhancement, has antibacterial and antiviral activity and can be used as a drug carrier and adjuvant for vaccines\u003csup\u003e[\u003cspan citationid=\"CR3\" class=\"CitationRef\"\u003e3\u003c/span\u003e]\u003c/sup\u003e. Although some studies have shown that \u003cem\u003eC.oleifera\u003c/em\u003e seed kernels are rich in squalene, the mechanism involved is not clear. Kim et al\u003csup\u003e[\u003cspan citationid=\"CR4\" class=\"CitationRef\"\u003e4\u003c/span\u003e]\u003c/sup\u003e. proved that squalene synthase (SQS) regulation is the key factor affecting squalene accumulationas assessed through the SQS deletion yeast erg9 mutant functional complementarity test\u003csup\u003e[\u003cspan citationid=\"CR5\" class=\"CitationRef\"\u003e5\u003c/span\u003e]\u003c/sup\u003e. However, under the same promoter, the ability of SQS mutant to resume squalene synthesis was significantly different after the complementary expression, which indicated the importance of transcription factors.\u003c/p\u003e\u003cp\u003eWRKY belongs to the WRKY-GCM1 zinc finger transcription factor superfamily, which is involved in plant growth, development, and physiological responses\u003csup\u003e[\u003cspan citationid=\"CR6\" class=\"CitationRef\"\u003e6\u003c/span\u003e, \u003cspan citationid=\"CR7\" class=\"CitationRef\"\u003e7\u003c/span\u003e]\u003c/sup\u003e. WRKY proteins in the plant kingdom form a large family of transcription factors that can be divided into at least three groups(GroupⅠ,GroupⅡ, and GroupⅢ) according to the characteristics of the structural domain\u003csup\u003e[\u003cspan citationid=\"CR8\" class=\"CitationRef\"\u003e8\u003c/span\u003e]\u003c/sup\u003e.The members of the WRKY family GroupⅠ contains two WRKYGQK domains, and the zinc fingerprint pattern is C-X4-5-C-X22-23H-X-H, such as AtWRKY33 in \u003cem\u003eArabidopsis thaliana\u003c/em\u003e\u003csup\u003e[\u003cspan citationid=\"CR9\" class=\"CitationRef\"\u003e9\u003c/span\u003e]\u003c/sup\u003e. The members of the WRKY family GroupⅡ contains only one WRKYGQK domain, and the zinc fingerprint pattern is the same as that of the first category, such as GmWRYK13\u003csup\u003e[\u003cspan citationid=\"CR10\" class=\"CitationRef\"\u003e10\u003c/span\u003e]\u003c/sup\u003e in soybean. The members of the WRKY family Group Ⅲ contains only one WRKYGQK domain, but the zinc fingerprint is the same. The structural amino acids changed to C-X7-C-X22-23-H-X-C, such as JrWRKY4\u003csup\u003e[\u003cspan citationid=\"CR11\" class=\"CitationRef\"\u003e11\u003c/span\u003e]\u003c/sup\u003e of \u003cem\u003ewalnuts\u003c/em\u003e.\u003c/p\u003e\u003cp\u003eYongzhen Sun\u003csup\u003e[\u003cspan citationid=\"CR12\" class=\"CitationRef\"\u003e12\u003c/span\u003e]\u003c/sup\u003e showed that the expression levels of HMGR, FPS2, SQS1, and SQE2 were higher than those of the control group after transformation of PqWRKY1 gene from \u003cem\u003eP. quinquefolius\u003c/em\u003e into \u003cem\u003eArabidopsis thaliana\u003c/em\u003e. WRKY binds to the W-box in the promoter region of key genes involved in triterpenoid synthesis in \u003cem\u003eArabidopsis thaliana\u003c/em\u003e and PqWRKY1 was characterised by structural domains typical of WRKY family class 2 members. Our group compared the changes of squalene content in \u003cem\u003eC.oleifera\u003c/em\u003e seed kernels during different developmental periods, constructed the transcriptome database, and based on the analysis that the CoSQS promoter contains a W-box cis-element, and retrieved the CoWRKY1 gene in the transcriptome database, which may interoperate with CoSQS, for yeast one-hybrid validation, we preliminarily demonstrated that squalene synthesis in \u003cem\u003eC.oleifera\u003c/em\u003e seed kernels is affected by the CoWRKY transcription factor. However, the CoWRKY transcription factor is a large gene family\u003csup\u003e[\u003cspan citationid=\"CR13\" class=\"CitationRef\"\u003e13\u003c/span\u003e]\u003c/sup\u003e, and it is not clear whether there are other members that also combine with CoSQS to affect squalene synthesis in \u003cem\u003eC.oleifera\u003c/em\u003e seed kernels.\u003c/p\u003e\u003cp\u003eIn this study, we combined \u003cem\u003eC.oleifera\u003c/em\u003e genomic data, constructed \u003cem\u003eC.oleifera\u003c/em\u003e seed kernel yeast libraries, used the CoSQS promoter as bait to regulate transcription factors that may interact with each other, and through AOS (Antibody Optimization System) analysis, identified the CoWRKY transcription gene CoWRKY15 with the highest interaction confidence, based on which we carried out bioinformatics analyses, prokaryotic expression and subcellular localization, and clarified the exogenous factor that most affects the expression of the CoWRKY genes through analysing their promoter sequences. By analysing its promoter sequence, the exogenous factor that most affects the expression of CoWRKY gene was clarified, and the squalene content was associated with the regulation of the expression of this CoWRKY through this exogenous factor, which further proved the role of CoWRKY transcription factor in affecting the squalene content of \u003cem\u003eC.oleifera\u003c/em\u003e seed kernel, and provided scientific basis for revealing the function of WRKY transcription factor in \u003cem\u003eC.oleifera\u003c/em\u003e seed kernel, and regulating the biosynthesis of squalene in plants by means of genetic engineering.\u003c/p\u003e\u003c/div\u003e\u003c/p\u003e"},{"header":"2. Materials and Methods","content":"\u003cdiv id=\"Sec3\" class=\"Section2\"\u003e \u003ch2\u003e2.1 Plant materials\u003c/h2\u003e \u003cp\u003e \u003cdiv class=\"BlockQuote\"\u003e \u003cp\u003eIn the gene cloning experiment, the seed kernels of national certified cultivar 'HS' were collected from the base of \u003cem\u003eC.oleifera\u003c/em\u003e in Dongcheng, Hunan, Wangcheng County, Changsha Province. The fluorescent quantitative test materials were \u003cem\u003eC.oleifera\u003c/em\u003e fruit under different light exposure conditions (Fig.\u0026nbsp;\u003cspan refid=\"Fig1\" class=\"InternalRef\"\u003e1\u003c/span\u003e) .\u003c/p\u003e \u003c/div\u003e \u003c/p\u003e \u003cp\u003e \u003c/p\u003e \u003cp\u003eLight not only affected the growth of \u003cem\u003eC.oleifera\u003c/em\u003e, but also had an impact on the metabolism of squalene\u003csup\u003e[\u003cspan citationid=\"CR14\" class=\"CitationRef\"\u003e14\u003c/span\u003e, \u003cspan citationid=\"CR15\" class=\"CitationRef\"\u003e15\u003c/span\u003e]\u003c/sup\u003e. Light exposure treatments included blue light (B), white light (W), red light (R), a red\u0026ndash;blue light combination (RB; red\u0026ndash;blue ratio: 1:1), and sunlight (CK). LED lights were used as light sources for treatment except for CK, including blue (450\u0026ndash;480 nm), red (610\u0026ndash;640 nm), and white (420\u0026ndash;720 nm) LED lights. Spectral characteristics of the different light quality treatments were measured with a HopooColor OHSP-350SF Spectral Color Luminance Meter (HopooColor, Hangzhou, China). The light source was placed above the three year-old \u003cem\u003eC.oleifera\u003c/em\u003e, and the height of the LED light source was adjusted to ensure that the photon flux density (PPFD) of each treated plant canopy is 200\u0026thinsp;\u0026plusmn;\u0026thinsp;10 \u0026micro;mol\u0026middot;m-2s-1 (Fig.\u0026nbsp;\u003cspan refid=\"Fig1\" class=\"InternalRef\"\u003e1\u003c/span\u003e)\u003c/p\u003e \u003c/div\u003e \u003cdiv id=\"Sec4\" class=\"Section2\"\u003e \u003ch2\u003e2.2 Real-Time PCR Quantification of Gene Expression\u003c/h2\u003e \u003cp\u003eThe relative expression of CoWRKY15 gene was analysed by real-time PCR using the cDNA of the test material as template, and CoEF1α gene was used as the internal reference gene, and three parallel replicates of the assay were done for each sample. The PCR primers for CoWRKY and CoEF1αF/CoEF1αR were F 5\u0026prime;- CTTTCGTCGTTGTCGGCGTTTC-3\u0026prime;, R 5 \u0026prime;- ACAATGGCAGCGGTCGGAAG-3\u0026prime;, F 5\u0026prime;- CAAAGAAGGGTGCCAAGTGA \u0026minus;\u0026thinsp;3\u0026prime; and R 5\u0026prime;- ACCAAACAACCGACCTACGA \u0026minus;\u0026thinsp;3\u0026prime;, respectively. The PCR reaction system was: 2 \u0026times; ChamQSYBR qPCR Master The PCR reaction system was as follows: 2 \u0026times; ChamQSYBR qPCR Master MixMix 10.0 \u0026micro;L, forward and reverse primers (10 Pmol.L-1) 0.4 \u0026micro;L each, 50 \u0026times; ROX Reference Dye1 0.4 \u0026micro;L, cDNA 0.5 \u0026micro;L, and ultrapure water 8.3 \u0026micro;L. The PCR amplification conditions were as follows: 95 ℃ pre-denaturation for 30 sec, 95 ℃ denaturation for 10 sec, and 60 ℃ annealing for 30 sec for a total of 40 cycles; dissolution curve 95 ℃ denaturation for 30 sec, and dissolution curve 95 ℃ denaturation for 30 sec for 40 cycles.\u003c/p\u003e \u003c/div\u003e \u003cdiv id=\"Sec5\" class=\"Section2\"\u003e \u003ch2\u003e2.3 Yeast one-hybrid screening\u003c/h2\u003e \u003cp\u003eRNA was extracted from Camellia oleifera using the Trizol method using (reverse transcription-polymerasechain reaction, RT-PCR) to obtain cDNA, the reaction system are: 2 \u0026micro;L of 5\u0026times; PrimeScriptRT Mix, 2 \u0026micro;g of Total RNA, RNase Free ddH\u003csub\u003e2\u003c/sub\u003eO to 10 \u0026micro;l. The reaction conditions were as follows: 25\u0026deg;C, 10 min; 42 ℃, 30 min; 85 ℃, 5min; 4℃, 3min.\u003c/p\u003e \u003cp\u003eAfter purification, it was homologously recombined with linear pGADT7 and transformed into \u003cem\u003eEscherichia coli\u003c/em\u003e to construct the \u003cem\u003eC.oleifera\u003c/em\u003e kernels cDNA library. The 1600bp upstream sequence of the \u003cem\u003eC.oleifera\u003c/em\u003e squalene synthase gene (\u003cem\u003eCoSQS\u003c/em\u003e) promoter was indroduced into pHIS2 and transformed into Y187 strain for background screening (Fig.\u0026nbsp;\u003cspan refid=\"Fig2\" class=\"InternalRef\"\u003e2\u003c/span\u003e), to determine the subsequent screening concentration using 75mM 3AT. The primers used for plasmid construction were pHIS2-CoSQS F: 5'-TACGACTCACTATAGGGCGAATTCGTTATGTTAG-3' and pHIS2-CoSQS R: 5 '-ATCGATTCGCGAACGCGTGAGCTCTTTTCTCTCT-3'. Using Y187 yeast containing the correct pHIS2-CoSQS- promoter bait plasmid as the receptor strain to prepare the competent cell, the cDNA library plasmid was transferred into it and 100 \u0026micro;L was applied to SD-LTH/75 mmol/L 3-AT culture Nutrient-based plates were incubated inversion at 30\u0026deg;C for 4\u0026ndash;6 days. The positive transformants grown on the SD-TLH\u0026thinsp;+\u0026thinsp;75 mM 3AT screening plate were scraped and subjected to NGS screening and sequencing.\u003c/p\u003e \u003cp\u003e \u003c/p\u003e \u003c/div\u003e \u003cdiv id=\"Sec6\" class=\"Section2\"\u003e \u003ch2\u003e2.4 Prokaryotic expression\u003c/h2\u003e \u003cp\u003eUsing the \u003cem\u003eC.oleifer\u003c/em\u003e cDNA of the test material as template, pET32a-CoWRKY15F 5'-GCCATGGCTGATATCGGATCCATGATGGCCGTCGAGCTCGTGATG-3' and pET32a-CoWRKY15R: 5 '- CTCGAGTGCGGCCGCAAGCTTTCAAGAAGACTCTAAGATAAG-3' as primers, the products obtained from PCR amplification were recovered and used in the ClonExpress II One Step Cloning Kit (Vazyme) to pET32a using homologous recombination. The 10 \u0026micro;L reaction system was: 5\u0026times;CEIIBuffer 2.0 \u0026micro;L, Exuase II 1.0 \u0026micro;L, recovered product (20\u0026ndash;100 ng) 2.0 \u0026micro;L, linearized vector 4.0 \u0026micro;L, and PCR-Grade Water 1.0 \u0026micro;L. The reaction conditions were: 37 ℃ for 30 min; 4 ℃ for 5 min.\u003c/p\u003e \u003cp\u003eSingle colonies of positive and transformed empty carriers were selected and cultured 3 mL liquid LB medium containing ampicillin for 12 h at 37\u0026deg;C. Subsequently, the culture was expanded in 200 mL with 1% inoculum and induced with 0.5 mM IPTG at OD600\u0026thinsp;=\u0026thinsp;0.8, followed by culture at 37℃ for 4 h. Then, the cell pellet was obtained by centrifugation for 2 min at 8000rpm and resuspended in an appropriate volume of Laemmli buffer, denatured at 100\u0026deg;C for 10 min, and subjected to SDS-PAGE.\u003c/p\u003e \u003c/div\u003e \u003cdiv id=\"Sec7\" class=\"Section2\"\u003e \u003ch2\u003e2.5 subcellular localization\u003c/h2\u003e \u003cp\u003eUsing the \u003cem\u003eC.oleifer\u003c/em\u003e cDNA of the test material as template, pCAMBIA1300-CoWRKY15F: 5'- gatcaagagacaggatccgATGATGGCCGTCGAGCTCGTGATG-3' and pCAMBIA1300-CoWRKY15R: 5'-tcaccatcggtgcactagtgTCAAGAAGACTCTAAGATAAG-3' as primers, the products obtained from PCR amplification were recovered and used in the ClonExpress II One Step Cloning Kit (Vazyme) to pCAMBIA1300 using homologous recombination.\u003c/p\u003e \u003cp\u003eChoose \u003cem\u003eNicotiana benthamiana\u003c/em\u003e leaves that are suitable for healthy, referring the live infection method of \u003cem\u003eAgrobacterium tumefaciens\u003c/em\u003e by Zeng Yanling et al\u003csup\u003e[\u003cspan citationid=\"CR16\" class=\"CitationRef\"\u003e16\u003c/span\u003e]\u003c/sup\u003e. \u003cem\u003eAgrobacterium tumefaciens\u003c/em\u003e containing recombinant plasmids were injected into \u003cem\u003eN. benthamiana\u003c/em\u003e leaves. The leaves were cultivated for 48 hours, and observed the fluorescence signal of eGFP under a laser confocal microscope excitation wavelength of 488 nm\u003csup\u003e[\u003cspan citationid=\"CR17\" class=\"CitationRef\"\u003e17\u003c/span\u003e]\u003c/sup\u003e.\u003c/p\u003e \u003c/div\u003e \u003cdiv id=\"Sec8\" class=\"Section2\"\u003e \u003ch2\u003e2.6 Squalene content analysis\u003c/h2\u003e \u003cp\u003e \u003cem\u003eCamella\u003c/em\u003e oil was extracted using Soxhlet extraction method\u003csup\u003e[\u003cspan citationid=\"CR18\" class=\"CitationRef\"\u003e18\u003c/span\u003e]\u003c/sup\u003e. Liquid chromatography (HPLC) was used to determine the squalene content in \u003cem\u003eCamellia\u003c/em\u003e oil. The detection conditions were as follows: Agilent reverse C18 column, mobile phase (methanol: acetonitrile\u0026thinsp;=\u0026thinsp;35:65), sample injection volume of 20 \u0026micro;L, flow rate of 1 mL/min, column temperature of 40 ℃, and detection wavelength of 210 nm.\u003c/p\u003e \u003c/div\u003e \u003cdiv id=\"Sec9\" class=\"Section2\"\u003e \u003ch2\u003e2.7 Data Analysis\u003c/h2\u003e \u003cp\u003eInteraction prediction was performed using AOS (Antibody Optimisation System), a software developed by Pronetbio Co\u003csup\u003e[\u003cspan citationid=\"CR19\" class=\"CitationRef\"\u003e19\u003c/span\u003e]\u003c/sup\u003e. The physical and chemical properties and structural characteristics of CoWRKY15 were predicted by on-line software ProtParam (\u003cspan class=\"ExternalRef\"\u003e\u003cspan class=\"RefSource\"\u003ehttps://web.expasy.org/protparam\u003c/span\u003e\u003cspan address=\"https://web.expasy.org/protparam\" targettype=\"URL\" class=\"RefTarget\"\u003e\u003c/span\u003e\u003c/span\u003e) and TMHMM (\u003cspan class=\"ExternalRef\"\u003e\u003cspan class=\"RefSource\"\u003ehttps://services.healthtech.dtu.dk/services/TMHMM-2.0\u003c/span\u003e\u003cspan address=\"https://services.healthtech.dtu.dk/services/TMHMM-2.0\" targettype=\"URL\" class=\"RefTarget\"\u003e\u003c/span\u003e\u003c/span\u003e). CoWRKY15 promoter cis-acting elements were predicted by PLACE (\u003cspan class=\"ExternalRef\"\u003e\u003cspan class=\"RefSource\"\u003ehttps://www.dna.affrc.go.jp/PLACE/?action=newplace\u003c/span\u003e\u003cspan address=\"https://www.dna.affrc.go.jp/PLACE/?action=newplace\" targettype=\"URL\" class=\"RefTarget\"\u003e\u003c/span\u003e\u003c/span\u003e).\u003c/p\u003e \u003cp\u003eThe phylogenetic tree was constructed and the cluster relationship was analyzed by using offline software MEGA11\u003csup\u003e[\u003cspan citationid=\"CR20\" class=\"CitationRef\"\u003e20\u003c/span\u003e]\u003c/sup\u003e. Fluorescence quantitative PCR(real-time PCR)data were analyzed by Bio-Rad CFX Manager software. The correlation was analyzed by SPSS Statistics22.0 software.\u003c/p\u003e \u003c/div\u003e"},{"header":"3. Results","content":"\u003cdiv id=\"Sec11\" class=\"Section2\"\u003e \u003ch2\u003e3.1 Obtaining WRKY transcription factors based on the CoSQS promoter yeast one-hybrid screen library\u003c/h2\u003e \u003cp\u003eAs the transcription factors of endogenous yeast may cause histidine excretion leakage, so it is necessary to add 3-AT to inhibit this leakage, in amino acids Auxotrophic medium SD-LTH was supplemented with 0, 5, 10, 20, 30, 40, 50, 75, 100mM, respectively mmol/L of 3-AT, which is determined by observing yeast growth Appropriate 3-AT inhibitory concentrations. When the concentration of 3-AT is increased to 75 mmol/L, Yeast in the test group and negative control the growth of the cells is completely inhibited, The positive control grew normally, The results indicated that pHIS2-CoSQS did not occur in yeast AH109 activation, Therefore, 75 mmol/L 3-AT can be used as the lowest inhibitory concentration yeast single bulk library screening was performed.\u003c/p\u003e \u003cp\u003eBased on the CoSQS promoter yeast single heterozygous screening library, a total of 1632 NGS sequences were obtained, which were related to 43 metabolic pathways such as signal transduction, environmental adaptation, fatty acid synthesis, and triterpenoid skeleton synthesis, including 379 transcription factors and 394 kinases (Fig.\u0026nbsp;\u003cspan refid=\"Fig3\" class=\"InternalRef\"\u003e3\u003c/span\u003ea). AOS analysis revealed 6 CoWRKY transcription factors interacting with CoSQS promoter that the CoWRKY transcription factor with the highest similarity to Camellia sinensis WRKY15\u003csup\u003e[\u003cspan citationid=\"CR21\" class=\"CitationRef\"\u003e21\u003c/span\u003e]\u003c/sup\u003e (GenBank number: XM_028196157) had the highest confidence in interacting with the CoSQS promoter sequence, which was 0.9026. The predicted results of both indicate 14 binding sites (Fig.\u0026nbsp;\u003cspan refid=\"Fig3\" class=\"InternalRef\"\u003e3\u003c/span\u003eb-e).\u003c/p\u003e \u003cp\u003e \u003c/p\u003e \u003c/div\u003e \u003cdiv id=\"Sec12\" class=\"Section2\"\u003e \u003ch2\u003e3.2 Bioinformatics analysis of CoWRKY15\u003c/h2\u003e \u003cp\u003e \u003cdiv class=\"BlockQuote\"\u003e \u003cp\u003eThe physical and chemical properties of CoWRKY15 were analyzed using on-line and off-line bioinformatics software. The results showed that the gene encoded 346 amino acids, the theoretical molecular weight (Mw) was 38297.31 Da, and the isoelectric point (pI) was 9.60, indicating that the protein was alkaline under physiological conditions. The number of negatively charged residues (Asp\u0026thinsp;+\u0026thinsp;Glu) was 33, the number of positively charged residues (Asp\u0026thinsp;+\u0026thinsp;Lys) is 49, and the molecular formula was C\u003csub\u003e1639\u003c/sub\u003eH\u003csub\u003e2674\u003c/sub\u003eN\u003csub\u003e508\u003c/sub\u003eO\u003csub\u003e518\u003c/sub\u003eS\u003csub\u003e16\u003c/sub\u003e. The instability index (II) is 52.84 for the typical unstable protein. The total average hydrophobicity (GRAVY) of the protein was \u0026minus;\u0026thinsp;0.616, which was predicted hydrophilicity.\u003c/p\u003e \u003cp\u003eProtParam predicted that 9.83% of CoWRKY15 protein was α-helical structure, 11.27% was β-folded, and 78.90% was irregularly coiled with no signal peptide. CoWRKY15 was predicted to function in eukaryotic nuclei with a confidence level of 43. TMHMM predicted the absence of a transmembrane region for the CoWRKY15 protein (Fig.\u0026nbsp;\u003cspan refid=\"Fig4\" class=\"InternalRef\"\u003e4\u003c/span\u003ea). The hydrophilic index of CoWRKY15 protein ranged from \u0026minus;\u0026thinsp;3.356 to 1.700, in which hydrophobic residues accounted for 67.34% of the entire amino acid residues, which was typical of hydrophobic proteins (Fig.\u0026nbsp;\u003cspan refid=\"Fig4\" class=\"InternalRef\"\u003e4\u003c/span\u003eb). The CoWRKY15 protein existed at one functional site, the WRKY structural domain, located at positions 268\u0026ndash;334 Aa, with the amino acid sequence \"KMSDIPPDDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPKMLIVTYEGEHNHSLS \". Judging from the conserved amino acid sequences contained and the structural features of the zinc finger, CoWRKY15 belonged to class 2 members of the WRKY family.\u003c/p\u003e \u003c/div\u003e \u003c/p\u003e \u003cp\u003e \u003c/p\u003e \u003c/div\u003e \u003cdiv id=\"Sec13\" class=\"Section2\"\u003e \u003ch2\u003e3.3 Phylogenetic tree analysis\u003c/h2\u003e \u003cp\u003e \u003cdiv class=\"BlockQuote\"\u003e \u003cp\u003eBased on previous studies\u003csup\u003e[\u003cspan citationid=\"CR22\" class=\"CitationRef\"\u003e22\u003c/span\u003e, \u003cspan citationid=\"CR23\" class=\"CitationRef\"\u003e23\u003c/span\u003e]\u003c/sup\u003e and the results of BLAST on \u003cspan class=\"ExternalRef\"\u003e\u003cspan class=\"RefSource\"\u003ehttp://www.ncbi.nlm.nih.gov\u003c/span\u003e\u003cspan address=\"http://www.ncbi.nlm.nih.gov\" targettype=\"URL\" class=\"RefTarget\"\u003e\u003c/span\u003e\u003c/span\u003e website, 19 plant WRKY amino acid sequences and CoWRKY15 amino acid sequences were selected for cluster analysis. The results showed that the genetic distance ranged from 0.0063 to 1.7279. CoWRKY15 had a genetic distance of 0.5564 with PqWRKY1 of \u003cem\u003eP. quinquefolius\u003c/em\u003e, thereby exhibiting a close genetic association. The genetic distance between CoWRKY15and AtWRKY2 homologous proteins of \u003cem\u003eArabidopsis thaliana\u003c/em\u003e was 1.5746 with the farthest genetic correlation (Fig.\u0026nbsp;\u003cspan refid=\"Fig5\" class=\"InternalRef\"\u003e5\u003c/span\u003ea). This phenomenon indicated that the WRKY gene family altered greatly during evolution. The conserved domain of the WRKY protein, was analyzed, and the AtWRKY66 of \u003cem\u003eA.thaliana\u003c/em\u003e was found to belong to type Ⅲ of the WRKY family. It contains only one WRKYGQK domain and has a typical zinc fingerprint of C-X7-C-X22-23-H-X-C. The AtWRKY26, AtWRKY33, and AtWRKY2 of \u003cem\u003eA.thaliana\u003c/em\u003e belonged to type Ⅰof the WRKY family and contain two WRKYGQK domains. The zinc fingerprinting pattern was C-X4-5-C-X22-23H-X-H. The other members belonged to typeⅡof the WRKY family with only one WRKYGQK domain (Fig.\u0026nbsp;\u003cspan refid=\"Fig5\" class=\"InternalRef\"\u003e5\u003c/span\u003eb). The zinc fingerprinting pattern was C-X4-5-C-X22-23H-X-H. CoWRKY15 of \u003cem\u003eC.oleifera\u003c/em\u003e belonged to typeⅡof the WRKY family ascribed to the typical characteristics of typeⅡmembers. However, the genetic distances with AtWRKY26, AtWRKY33, and AtWRKY2 of typeⅠmembers were closer than those of AtWRKY40, AtWRKY18, and AtWRKY60 of typeⅡmembers. This phenomenon might be attributed to the fact that the first type members of the WRKY family constituted the branch of origin, that differentiated into several subclasses in order to adapt to the environment. Thus, the genetic distance between different subclasses becomed longer.\u003c/p\u003e \u003c/div\u003e \u003c/p\u003e \u003cp\u003e \u003c/p\u003e \u003c/div\u003e \u003cdiv id=\"Sec14\" class=\"Section2\"\u003e \u003ch2\u003e3.4 Analysis of CoWRKY15 expression in prokaryotes\u003c/h2\u003e \u003cp\u003e \u003cdiv class=\"BlockQuote\"\u003e \u003cp\u003eThe recombinant plasmid pET32a-\u003cem\u003eCoWRKY15\u003c/em\u003e and empty plasmid pET32a were transformed into E. coli Rosseta (DE3), respectively. The expression of \u003cem\u003eCoWRKY15\u003c/em\u003e in \u003cem\u003eE. coli\u003c/em\u003e was analyzed by SDS-PAGE after IPTG induction. ProtParam, an online software, demonstrated that CoWRKY15 gene was expressed at about 38.2 kDa. The protein expressed as a His-tag sequence at N-terminal of the expression system also induced to express about 23.8 kDa, such that the expected expression level of the fusion protein was about 60 kDa. SDS-PAGE displayed a fusion protein band of about 60 kDa, while only the labeled protein band was induced in the empty plasmid strains, and no specific protein band was detected in the non-induced transformed recombinant plasmid strains (Fig.\u0026nbsp;\u003cspan refid=\"Fig6\" class=\"InternalRef\"\u003e6\u003c/span\u003e). The recombinant plasmid pET32a-\u003cem\u003eCoWRKY15\u003c/em\u003e was successfully induced to express the CoWRKY15 protein in \u003cem\u003eE. coli\u003c/em\u003e.\u003c/p\u003e \u003c/div\u003e \u003c/p\u003e \u003cp\u003e \u003c/p\u003e \u003c/div\u003e \u003cdiv id=\"Sec15\" class=\"Section2\"\u003e \u003ch2\u003e3.5 CoWRKY15 subcellular localization\u003c/h2\u003e \u003cp\u003e \u003cdiv class=\"BlockQuote\"\u003e \u003cp\u003eThe fusion expression vector was transformed into tobacco leaves by the tobacco injection method, and CoWRKY15 was efficiently transiently expressed in the vicinity of the injected area after 48 h of incubation. eGFP fluorescence signals in tobacco leaves were observed under a confocal laser microscope, and the results showed that eGFP fluorescence signals completely overlapped with autofluorescence signals of the nucleus under the excitation of 543 nm light (Fig.\u0026nbsp;\u003cspan refid=\"Fig7\" class=\"InternalRef\"\u003e7\u003c/span\u003e), which indicated that CoWRKY15 might be located in the nucleus, which is in agreement with the results of the bioinformatics analyses.\u003c/p\u003e \u003c/div\u003e \u003c/p\u003e \u003cp\u003e \u003c/p\u003e \u003c/div\u003e \u003cdiv id=\"Sec16\" class=\"Section2\"\u003e \u003ch2\u003e3.6 Analysis of Cis-Acting Elements in the CoWRKY15 Promoter\u003c/h2\u003e \u003cp\u003e \u003cdiv class=\"BlockQuote\"\u003e \u003cp\u003ePlant Care, an online promoter analysis database, analyzed the 2000 bp sequence of the upstream non-coding region of \u003cem\u003eCoWRKY15\u003c/em\u003e for cis-elements (Table\u0026nbsp;\u003cspan refid=\"Tab1\" class=\"InternalRef\"\u003e1\u003c/span\u003e), which showed that the sequence contained 14 types of cis-acting elements with annotated functions, including eight elements involved in the light response (AE-box, AT1-motif, Box 4, G-box, L-box, LAMP-element, Sp1, Chs-CMA2a), one cis-acting element involved in abscisic acid response (ABRE), and two methyl jasmonate-responsive elements (CGTCA-motif, TGACG-motif). These results suggested that \u003cem\u003eCoWRKY15\u003c/em\u003e gene expression might be regulated by photosystems and hormone-like signaling substances.\u003c/p\u003e \u003c/div\u003e \u003c/p\u003e \u003cp\u003e \u003cdiv class=\"gridtable\"\u003e\u003ctable float=\"Yes\" id=\"Tab1\" border=\"1\"\u003e \u003ccaption language=\"En\"\u003e \u003cdiv class=\"CaptionNumber\"\u003eTable 1\u003c/div\u003e \u003cdiv class=\"CaptionContent\"\u003e \u003cp\u003ePrediction of cis-acting elements in the CoWRKY15 promoter.\u003c/p\u003e \u003c/div\u003e \u003c/caption\u003e \u003ccolgroup cols=\"5\"\u003e \u003cdiv align=\"left\" class=\"colspec\" colname=\"c1\" colnum=\"1\"\u003e\u003c/div\u003e \u003cdiv align=\"left\" class=\"colspec\" colname=\"c2\" colnum=\"2\"\u003e\u003c/div\u003e \u003cdiv align=\"left\" class=\"colspec\" colname=\"c3\" colnum=\"3\"\u003e\u003c/div\u003e \u003cdiv align=\"left\" class=\"colspec\" colname=\"c4\" colnum=\"4\"\u003e\u003c/div\u003e \u003cdiv align=\"left\" class=\"colspec\" colname=\"c5\" colnum=\"5\"\u003e\u003c/div\u003e \u003cthead\u003e \u003ctr\u003e \u003cth align=\"left\" colname=\"c1\"\u003e \u003cp\u003ecis-regulatory element\u003c/p\u003e \u003c/th\u003e \u003cth align=\"left\" colname=\"c2\"\u003e \u003cp\u003ecore sequence\u003c/p\u003e \u003c/th\u003e \u003cth align=\"left\" colspan=\"2\" nameend=\"c4\" namest=\"c3\"\u003e \u003cp\u003ePosition and Strand\u003c/p\u003e \u003c/th\u003e \u003cth align=\"left\" colname=\"c5\"\u003e \u003cp\u003efunction\u003c/p\u003e \u003c/th\u003e \u003c/tr\u003e \u003c/thead\u003e \u003ctbody\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eA-box\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eCCGTCC\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e9(-)/679(+)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003eCis-acting regulatory element\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eABRE\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eACGTG\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e235(+)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003eCis-acting elements involved in the abscisic acid responsiveness\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eAE-box\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eAGAAACAA\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e1146(-)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003ePart of a module for light respone\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eARE\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eAAACCA\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e1524(-)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003eCis-acting regulatory element essential for the anaerobic induction\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eAT-rich element\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eATAGAAATCAA\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e899(-)/1284(+)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003eBinding site of AT-rich DNA binding protein (ATBP-1)\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eAT1-motif\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eAATTATTTTTTATT\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e1796(-)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003ePart of a light responsive module\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eBox4\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eATTAAT\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e288(+)/1807(-)/1476(-)\u003c/p\u003e \u003cp\u003e968(+)/1618(-)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003ePart of a conserved DNAmodule involved in light responsiveness\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eCGTCA-motif\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eCGTCA\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e1308(-)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003ecis-acting regulatory element involved in the MeJA-responsiveness\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eG-box\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eTACGTG\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e234(+)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003ecis-acting regulatory element involved in light responsiveness\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eL-box\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eATCCCACCTAC\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e707(+)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003ePart of a light responsive element\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eLAMP-element\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eCTTTATCA\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e143(-)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003ePart of a light responsive element\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eSp1\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eGGGCGG\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e728(-)/1657(-)/774(-)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003eLight responsive element\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eTGACG-motif\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eTGACG\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e1308(+)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003ecis-acting regulatory element involved in the MeJA-responsiveness\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd align=\"left\" colname=\"c1\"\u003e \u003cp\u003eChs-CMA2a\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c2\"\u003e \u003cp\u003eTCACTTGA\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colname=\"c3\"\u003e \u003cp\u003e1099(-)\u003c/p\u003e \u003c/td\u003e \u003ctd align=\"left\" colspan=\"2\" nameend=\"c5\" namest=\"c4\"\u003e \u003cp\u003ePart of a light responsive element\u003c/p\u003e \u003c/td\u003e \u003c/tr\u003e \u003c/tbody\u003e \u003c/colgroup\u003e \u003c/table\u003e\u003c/div\u003e \u003c/p\u003e \u003c/div\u003e \u003cdiv id=\"Sec17\" class=\"Section2\"\u003e \u003ch2\u003e3.7 Effect of CoWRKY15 expression on squalene content under different light qualities\u003c/h2\u003e \u003cp\u003e \u003cdiv class=\"BlockQuote\"\u003e \u003cp\u003ehe \u003cem\u003eCoWRKY15\u003c/em\u003e promoter sequence contained at least eight light-responsive elements (Table\u0026nbsp;\u003cspan refid=\"Tab1\" class=\"InternalRef\"\u003e1\u003c/span\u003e). Significant differences in the \u003cem\u003eCoWRKY15\u003c/em\u003e expression and squalene content were observed after different light quality treatments (Fig.\u0026nbsp;\u003cspan refid=\"Fig6\" class=\"InternalRef\"\u003e6\u003c/span\u003e), and bivariate correlation analysis of the two parameters yielded a Pearson correlation of 0.798 and a significance of 0.106.\u003c/p\u003e \u003c/div\u003e \u003c/p\u003e \u003c/div\u003e"},{"header":"4. Discussion","content":"\u003cp\u003e \u003cdiv class=\"BlockQuote\"\u003e \u003cp\u003e \u003cem\u003eCamellia oleifera\u003c/em\u003e is rich in squalene, that is a pivotal product of the terpene metabolic pathway. Some studies have shown that the key enzyme gene affecting squalene synthesis is SQS\u003csup\u003e[\u003cspan citationid=\"CR24\" class=\"CitationRef\"\u003e24\u003c/span\u003e]\u003c/sup\u003e. A previous study by our group found that the expression of CoSQS was regulated by the transcription factor WRKY\u003csup\u003e[\u003cspan citationid=\"CR25\" class=\"CitationRef\"\u003e25\u003c/span\u003e]\u003c/sup\u003e. WRKY is a transcriptional regulator occurring widely throughout the plant kingdom. It participates in regulating the biological and abiotic stresses and physiological responses of various metabolic pathways and is closely related to plant growth, development, and senescence\u003csup\u003e[\u003cspan citationid=\"CR26\" class=\"CitationRef\"\u003e26\u003c/span\u003e, \u003cspan citationid=\"CR27\" class=\"CitationRef\"\u003e27\u003c/span\u003e]\u003c/sup\u003e. WRKY TFs can specifically recognize the W-box, with sequence TTGAC/T within the target genes\u0026rsquo; promoter regions\u003csup\u003e[\u003cspan citationid=\"CR28\" class=\"CitationRef\"\u003e28\u003c/span\u003e]\u003c/sup\u003e. Hanting Yang\u003csup\u003e[\u003cspan citationid=\"CR29\" class=\"CitationRef\"\u003e29\u003c/span\u003e]\u003c/sup\u003e also found that WRKY functions as a transcriptional regulator of plant secondary metabolite synthesis. In this study, we used bioinformatics to analyze six WRKY transcription factors that might interact with \u003cem\u003eCoSQS\u003c/em\u003e, among which the CoWRKY15 transcription factor, which had the highest confidence of interaction, was not the same as the CoWRKY1 transcription factor that was obtained by our group based on transcriptome analysis in the previous stage. Multiple WRKY transcription factors that might affect terpenoid metabolism had also been found in \u003cem\u003ePanax ginseng\u003c/em\u003e\u003csup\u003e[\u003cspan citationid=\"CR30\" class=\"CitationRef\"\u003e30\u003c/span\u003e]\u003c/sup\u003e. The synthesis of terpenoid metabolites could be induced by herbivory, wounding, light, low temperatures, and other stress conditions\u003csup\u003e[\u003cspan citationid=\"CR31\" class=\"CitationRef\"\u003e31\u003c/span\u003e]\u003c/sup\u003e. It was possible that the WRKY transcription factors that bind to the CoSQS promoter were not the same under different conditions, leading to differences in the outcome of transcriptional regulation, which ultimately exhibited differences in squalene content.\u003c/p\u003e \u003cp\u003eAccording to the number of WRKY domains and the characteristics of a zinc finger structure, WRKY could be divided into Groups I, II, and III. Group II can be further divided into five sub-categories: IIa, IIb, IIc, IId, and IIe\u003csup\u003e[\u003cspan citationid=\"CR32\" class=\"CitationRef\"\u003e32\u003c/span\u003e]\u003c/sup\u003e. The deduced amino acid sequence of CoWRKY15 gene of \u003cem\u003eC.oleifera\u003c/em\u003e consisted of a typical WRKY domain and C2H2zinc finger structure, categorized into the second group of WRKY members. CoWRKY15 is genetically most distant from PqWRKY1, which was the 1st transcription factor gene cloned and identified in \u003cem\u003eP.quinquefolius\u003c/em\u003e that might be involved in the regulation of triterpenoid saponin synthesis, and could regulate squalene synthesis in combination with the W-box structural domain of the promoter region of the SQS gene\u003csup\u003e[\u003cspan citationid=\"CR33\" class=\"CitationRef\"\u003e33\u003c/span\u003e]\u003c/sup\u003e. CoWRKY15 and PqWRKY1 were clustered together and had similar structural characteristics, further indicating that CoWRKY15 had the function of transcriptional regulation of squalene synthesis in \u003cem\u003eC.oleifera\u003c/em\u003e.\u003c/p\u003e \u003cp\u003eUV-B treatment of one-year-old potted \u003cem\u003eC. sinensis\u003c/em\u003e cv. Longjing-43 differentially altered the metabolism of terpenoids with significant effects after 8 h of treatment, demonstrating the strong potential of UV-B application for flavor improvement in tea\u003csup\u003e[\u003cspan citationid=\"CR34\" class=\"CitationRef\"\u003e34\u003c/span\u003e]\u003c/sup\u003e. This study used different wavelengths light to treat reproductive period \u003cem\u003eC.oleifera\u003c/em\u003e, and the results showed that different wavelengths light also had a significant impact on the content of squalene in \u003cem\u003eC.oleifera\u003c/em\u003e kernels. The correlation analysis between squalene content in \u003cem\u003eC. oleifera\u003c/em\u003e seeds and CoW RKY15 expression under different light quality conditions showed a positive correlation between the two, but the correlation did not reach a very significant level. This may be because CoSQS directly regulated the synthesis of squalene, while CoWRKY15 affected the squalene content in \u003cem\u003eC. oleifera\u003c/em\u003e kernels by regulating the expression of CoSQS. In addition, bioinformatics software predicts that CoWRKY15 was a hydrophilic non transmembrane 38.2 kD protein located in the nucleus. This study confirmed the predicted results through prokaryotic expression and subcellular localization methods. CoWRKY15 was localized in the nucleus consistent with a location where transcription factors played a role.\u003c/p\u003e \u003c/div\u003e \u003c/p\u003e \u003cp\u003eThis study analyzed the effect of CoWRKY15 transcription factor on the accumulation of squalene in \u003cem\u003eC. oleifera\u003c/em\u003e seeds through multiple pathways. However, whether there are other members of the CoWRKY family interacting with \u003cem\u003eCoSQS\u003c/em\u003e, and what factors affect interaction selection still need to explored.\u003c/p\u003e"},{"header":"5.Conclusion","content":"\u003cp\u003e \u003cdiv class=\"BlockQuote\"\u003e \u003cp\u003eCoWRKY transcription factors were present in \u003cem\u003eC.oleifera\u003c/em\u003e seed kernel in the form of a multigene family, among which CoWRKY15 interacts with CoSQS with the highest predicted confidence.CoWRKY15 belonged to the second class of members in the WRKY family, encoding 346 aa, which was a hydrophilic protein without transmembrane structure of about 38.2 kD in size, and it functioned in the nucleus. The wavelength of light had a significant effect on the squalene content of \u003cem\u003eC.oleifera\u003c/em\u003e seed kernels, and CoWRKY15 transcription factor positively regulated the squalene content of \u003cem\u003eC.oleifera\u003c/em\u003e seed kernels under this condition.\u003c/p\u003e \u003c/div\u003e \u003c/p\u003e"},{"header":"Declarations","content":"\u003cp\u003e\u003cstrong\u003eAuthor Contributions:\u0026nbsp;\u003c/strong\u003eY.Z. conceived and designed the experiments; Q.D., L.G., A. L. and Z.Z. performed the experiment, data collection, lab analysis, and data analysis. Q.D and L.G. wrote the paper; Y.Z. edited the paper. All authors have read and agreed to the published version of the manuscript.\u003c/p\u003e\n\u003cp\u003e\u003cstrong\u003eFunding:\u0026nbsp;\u003c/strong\u003eThis work was supported by the Major Program of Natural Science Foundation of Hunan Province (2021JC0007), the Natural Science Foundation of Hunan Province (2022JJ30998), and the Fundamental Research Funds of Forestry Department of Hunan Province (XLKY202221).\u003c/p\u003e\n\u003cp\u003e\u003cstrong\u003eData Availability Statement:\u0026nbsp;\u003c/strong\u003eData are contained within the article.\u003c/p\u003e\n\u003cp\u003e\u003cstrong\u003eConflicts of Interest:\u0026nbsp;\u003c/strong\u003eThe authors declare no conflict of interest.\u003c/p\u003e\n\u003cp\u003e\u003cstrong\u003eEthics approval and consent to participate:\u003c/strong\u003e Not applicable.\u003c/p\u003e"},{"header":"References","content":"\u003col\u003e\n\u003cli\u003eLIN P, WANG K, WANG Y, et al. The genome of oil-Camellia and population genomics analysis provide insights into seed oil domestication [J]. Genome biology, 2022, 23(1): 14.\u003c/li\u003e\n\u003cli\u003eHAO L I, XUE-ZHI F, HAI-YAN Z, et al. Variation of Physicochemical Properties and Nutritional Components of Oil-tea Camellia Seeds during Riping [J]. Forest Research, 2014, 27(1): 86-91.\u003c/li\u003e\n\u003cli\u003eTATENO M, STONE B J, SRODULSKI S J, et al. Synthetic Biology-derived triterpenes as efficacious immunomodulating adjuvants [J]. Scientific Reports, 2020, 10(1): 17090.\u003c/li\u003e\n\u003cli\u003eKIM T D, HAN J Y, HUH G H, et al. Expression and Functional Characterization of Three Squalene Synthase Genes Associated with Saponin Biosynthesis in Panax ginseng [J]. Plant and Cell Physiology, 2011, 52(1): 125-37.\u003c/li\u003e\n\u003cli\u003eBRAMLEY P M, ELMADFA I, KAFATOS A, et al. Vitamin E (p 913-938) [J]. journal of the science of food\\\u0026amp;\\agriculture, 2010, 80(7).\u003c/li\u003e\n\u003cli\u003eBAKSHI M, OELM\u0026uuml;LLER R. WRKY transcription factors [J]. Plant Signaling \u0026amp; Behavior, 2014.\u003c/li\u003e\n\u003cli\u003eFENG W, XIAO-ZHU W U, LIANG L, et al. Research advances on physiological function of WRKY transcription factor in plant stress resistance [J]. Guihaia, 2017.\u003c/li\u003e\n\u003cli\u003eRUSHTON P J, SOMSSICH I E, RINGLER P, et al. WRKY transcription factors [J]. Trends in Plant Science, 2010, 15(5): 247-58.\u003c/li\u003e\n\u003cli\u003eABUQAMAR S, CHEN X, DHAWAN R, et al. Expression profiling and mutant analysis reveals complex regulatory networks involved in Arabidopsis response to Botrytis infection [J]. The Plant Journal, 2006, 48(1): 28-44.\u003c/li\u003e\n\u003cli\u003eZHOU Q Y, TIAN A G, ZOU H F, et al. Soybean WRKY-type transcription factor genes, GmWRKY13, GmWRKY21, and GmWRKY54, confer differential tolerance to abiotic stresses in transgenic Arabidopsis plants [J]. Plant Biotechnology Journal, 2008, 6(5): 486-503.\u003c/li\u003e\n\u003cli\u003eLI X U, XIN C, HAI-RONG W, et al. Cloning and Expression Analysis of WRKY4 Gene from Juglans regia L [J]. Journal of Nuclear Agricultural Sciences, 2014, 28(7): 1188-96.\u003c/li\u003e\n\u003cli\u003eHARA M, FURUKAWA J, SATO A, et al. Abiotic Stress and Role of Salicylic Acid in Plants [J]. Springer New York, 2012.\u003c/li\u003e\n\u003cli\u003eMUHAMMAD, WAQAS, MUHAMMAD, et al. Genome-wide identification and expression analyses of WRKY transcription factor family members from chickpea (Cicer arietinum L.) reveal their role in abiotic stress-responses [J]. Genes \u0026amp; Genomics, 2019.\u003c/li\u003e\n\u003cli\u003eBEL\u0026eacute;N, GONZ\u0026aacute;LEZ, AMOR\u0026oacute;S, et al. A model study into the effects of light and temperature on the degradation of fingerprint constituents [J]. Science \u0026amp; Justice, 2014.\u003c/li\u003e\n\u003cli\u003eHE C, ZENG Y, FU Y, et al. Light quality affects the proliferation of in vitro cultured plantlets of Camellia oleifera Huajin [J]. PeerJ, 2020, 8(3): e10016.\u003c/li\u003e\n\u003cli\u003eYAN-LING Z, DANG-QUAN Z, XIAO-FENG Z, et al. Molecular Characterization and Expression Analysis of Squalene Synthetase Gene( CoSQS) from Camellia oleifera [J]. Journal of Plant Genetic Resources, 2016.\u003c/li\u003e\n\u003cli\u003eHIEI Y. Efficient transformation of rice (Oryza sativa L.) mediated by Agrobacterium and sequence analysis of the boundaries of the T-DNA [J]. Plant J, 1994, 6.\u003c/li\u003e\n\u003cli\u003eYANG H, BI W Y, CHEN H X, et al. Contrastive Studies of Coal between Direct Ultrasonic Extraction and Soxhlet Extraction [J]. Advanced Materials Research, 2011, 236-238.\u003c/li\u003e\n\u003cli\u003eOHUE M, SHIMODA T, SUZUKI S, et al. MEGADOCK 4.0: an ultra\u0026ndash;high-performance protein\u0026ndash;protein docking software for heterogeneous supercomputers [J]. Bioinformatics, 2014, 30(22).\u003c/li\u003e\n\u003cli\u003eKOICHIRO T, GLEN S, SUDHIR K. MEGA11: Molecular Evolutionary Genetics Analysis Version 11 [J]. Molecular Biology and Evolution, (7): 7.\u003c/li\u003e\n\u003cli\u003eEN-HUA, HAI-BIN, ZHANG, et al. The Tea Tree Genome Provides Insights into Tea Flavor and Independent Evolution of Caffeine Biosynthesis [J]. 分子植物:英文版, 2017, (6): 866-77.\u003c/li\u003e\n\u003cli\u003eREN X, CHEN Z, LIU Y, et al. ABO3, a WRKY transcription factor, mediates plant responses to abscisic acid and drought tolerance in Arabidopsis [J]. The Plant Journal, 2010.\u003c/li\u003e\n\u003cli\u003eWENBO, JIANGDIQIU, YU. Arabidopsis WRKY2 transcription factor mediates seed germination and postgermination arrest of development by abscisic acid [J]. Bmc Plant Biology, 2009.\u003c/li\u003e\n\u003cli\u003eSUO J, TONG K, WU J, et al. Comparative transcriptome analysis reveals key genes in the regulation of squalene and \u0026beta;-sitosterol biosynthesis in Torreya grandis [J]. Industrial Crops and Products, 2019, 131: 182-93.\u003c/li\u003e\n\u003cli\u003eYANG R, YAN Y, ZENG Y, et al. Correlation between squalene synthase promoter and WRKY transcription factor in Camellia oleifera [J]. Journal of Horticultural Science and Biotechnology, 2020: 1-10.\u003c/li\u003e\n\u003cli\u003eLAGAC\u0026eacute; M, MATTON D P. Characterization of a WRKY transcription factor expressed in late torpedo-stage embryos of Solanum chacoense [J]. Planta, 2004, 219(1): 185-9.\u003c/li\u003e\n\u003cli\u003eXU X, CHEN C, CHEN F Z. Physical and Functional Interactions between Pathogen-Induced Arabidopsis WRKY18, WRKY40, and WRKY60 Transcription Factors [J]. Plant Cell, 2006, 18(5): 1310-26.\u003c/li\u003e\n\u003cli\u003eCIOLKOWSKI I, WANKE D, BIRKENBIHL R P, et al. Studies on DNA-binding selectivity of WRKY transcription factors lend structural clues into WRKY-domain function [J]. Plant Molecular Biology, 2008, 68(1-2): 81-92.\u003c/li\u003e\n\u003cli\u003eYANG H, LI H, LI Q. Biosynthetic regulatory network of flavonoid metabolites in stems and leaves of [J]. Scientific Reports.\u003c/li\u003e\n\u003cli\u003eDI P, WANG P, YAN M, et al. Genome-wide characterization and analysis of WRKY transcription factors in Panax ginseng [J]. BMC Genomics, 2021, (1).\u003c/li\u003e\n\u003cli\u003eWEN B, LUO Y, LIU D, et al. The R2R3-MYB transcription factor CsMYB73 negatively regulates L-Theanine biosynthesis in tea plants (Camellia sinensis L.) [J]. Plant Science: An International Journal of Experimental Plant Biology, 2020, (298-): 298.\u003c/li\u003e\n\u003cli\u003eLEI L, BINGYAN X, XIAOFENG D, et al. WRKY Transcription Factors and Their Roles in Plant Defense Responses [J]. Molecular Plant Breeding, 2005, 3: 401-8.\u003c/li\u003e\n\u003cli\u003eZENG, GUO, LP, et al. Arbuscular mycorrhizal symbiosis and active ingredients of medicinal plants: current research status and prospectives [J]. MYCORRHIZA, 2013, 2013,23(4)(-): 253-65.\u003c/li\u003e\n\u003cli\u003eSHAMALA L, ZHOU H, HAN Z, et al. UV-B Induces Distinct Transcriptional Re-programing in UVR8-Signal Transduction, Flavonoid, and Terpenoids Pathways inCamellia sinensis [J]. Frontiers in plant science, 2020, 11: 234.\u003c/li\u003e\n\u003c/ol\u003e"}],"fulltextSource":"","fullText":"","funders":[],"hasAdminPriorityOnWorkflow":false,"hasManuscriptDocX":true,"hasOptedInToPreprint":true,"hasPassedJournalQc":"","hasAnyPriority":false,"hideJournal":true,"highlight":"","institution":"","isAcceptedByJournal":false,"isAuthorSuppliedPdf":false,"isDeskRejected":"","isHiddenFromSearch":false,"isInQc":false,"isInWorkflow":false,"isPdf":false,"isPdfUpToDate":true,"isWithdrawnOrRetracted":false,"journal":{"display":true,"email":"[email protected]","identity":"researchsquare","isNatureJournal":false,"hasQc":true,"allowDirectSubmit":true,"externalIdentity":"","sideBox":"","snPcode":"","submissionUrl":"/submission","title":"Research Square","twitterHandle":"researchsquare","acdcEnabled":true,"dfaEnabled":false,"editorialSystem":"","reportingPortfolio":"","inReviewEnabled":false,"inReviewRevisionsEnabled":true},"keywords":"Camellia oleifera, Squalene, CoWRKY transcription factor, expression","lastPublishedDoi":"10.21203/rs.3.rs-4204992/v1","lastPublishedDoiUrl":"https://doi.org/10.21203/rs.3.rs-4204992/v1","license":{"name":"CC BY 4.0","url":"https://creativecommons.org/licenses/by/4.0/"},"manuscriptAbstract":"\u003cp\u003eWRKY-like transcriptional regulators are widely involved in physiological processes such as growth and development, metabolic regulation and environmental response. In this study, we obtained six CoWRKY transcription factors by yeast one-hybrid screening library with reference to the \u003cem\u003eCamellia oleifera\u003c/em\u003e genome sequence, using squalene synthase gene (CoSQS) as bait. AOS (Antibody Optimization System) analysis showed that CoWRKY15 had the highest interactions with a confidence level of 0.9026. Bioinformatics analysis showed that CoWRKY15 encodes 346 amino acid residues, was a basic hydrophilic protein, did not contain a transmembrane region, contained one WRKY conserved structural domain and one C2H2 zinc finger structural domain. and belonged to class 2 of the WRKY gene family, and had the closest genetic distance of 0.5564 to the homologous protein of \u003cem\u003ePanax quinquefolius\u003c/em\u003e PqWRKY1. The results of prokaryotic expression showed that the CoWRK15 protein with a size of 38.3 kD was successfully induced by adding a final concentration of 0.5 mM ITPG for 4 h at 37℃. The results of subcellular localization showed that CoWRKY15 functioned in the nucleus. The results of CoWRKY15 promoter analysis showed that 8 out of 14 cis-elements with annotatable functions were related to the light response, indicating that the expression of CoWRKY15 was strongly affected by light. The correlation analysis of CoWRKY15 expression and squalene content in \u003cem\u003eCamellia oleifera\u003c/em\u003e seed kernels treated under different light quality conditions showed a significant positive correlation.\u003c/p\u003e","manuscriptTitle":"Identification and expression characterization of a WRKY transcription factor affecting squalene synthesis in Camellia oleifera","msid":"","msnumber":"","nonDraftVersions":[{"code":1,"date":"2024-04-09 06:06:57","doi":"10.21203/rs.3.rs-4204992/v1","editorialEvents":[{"type":"communityComments","content":0}],"status":"published","journal":{"display":true,"email":"[email protected]","identity":"researchsquare","isNatureJournal":false,"hasQc":true,"allowDirectSubmit":true,"externalIdentity":"","sideBox":"","snPcode":"","submissionUrl":"/submission","title":"Research Square","twitterHandle":"researchsquare","acdcEnabled":true,"dfaEnabled":false,"editorialSystem":"","reportingPortfolio":"","inReviewEnabled":false,"inReviewRevisionsEnabled":true}}],"origin":"","ownerIdentity":"c10b1162-130c-445e-a710-49b1ac223409","owner":[],"postedDate":"April 9th, 2024","published":true,"recentEditorialEvents":[],"rejectedJournal":[],"revision":"","amendment":"","status":"posted","subjectAreas":[],"tags":[],"updatedAt":"2024-04-09T14:52:56+00:00","versionOfRecord":[],"versionCreatedAt":"2024-04-09 06:06:57","video":"","vorDoi":"","vorDoiUrl":"","workflowStages":[]},"version":"v1","identity":"rs-4204992","journalConfig":"researchsquare"},"__N_SSP":true},"page":"/article/[identity]/[[...version]]","query":{"redirect":"/article/rs-4204992","identity":"rs-4204992","version":["v1"]},"buildId":"qtupq5eGEP_6zYnWcrvyt","isFallback":false,"isExperimentalCompile":false,"dynamicIds":[84888],"gssp":true,"scriptLoader":[]}

Text is read by the "Ask this paper" AI Q&A widget below. Extraction quality varies by source — PMC NXML preserves structure cleanly, OA-HTML may include some navigation residue, and OA-PDF can have broken hyphenation. The publisher copy (via DOI) is the canonical version.

My notes (saved in your browser only)

Ask this paper AI returns verbatim quotes from the full text · source: preprint-html

Answers must be backed by verbatim quotes from this paper's full text. Hallucinated quotes are dropped automatically; if no verbatim passage answers the question, we say so. How this works

Citation neighborhood (no data yet)

We don't have any in-corpus citations linked to this paper yet. This is a recent paper (2024) — citers typically take a year or two to land, and the OpenAlex reference graph may still be filling in.

Source provenance

europepmc
last seen: 2026-05-20T01:45:00.602351+00:00