Fibrilpaint20 directs the ubiquitin–proteasome system to Tau amyloid fibrils

preprint OA: closed CC-BY-NC-4.0
📄 Open PDF Full text JSON View at publisher

Abstract

Summary Failure of the Protein Quality Control (PQC) System to control the Tau protein leads to amyloid fibrils that are at the basis of various Tauopathies, including Alzheimer’s Disease (AD). Reinstating the PQC for Tau is desirable. Here we show that the PROTAC peptide FibrilPaint20 (FP20) recruits the ubiquitination system to Tau amyloid fibrils. We reconstituted the ubiquitin-proteasome cascade and monitored the stepwise ubiquitin transfer using the microfluidics technique FIDA. To direct ubiquitination specifically to amyloids, we discovered FP20, a bifunctional peptide that connects amyloid fibrils to the E3 ligase CHIP. FP20 mediated ubiquitination of recombinant and patient derived fibrils from various tauopathies, ultimately enabling the 26S proteasome to target CHIP-ubiquitinated Tau fibrils. This shows that FP20 cooperates with the PQC system and can initiate fibril cleavage. This offers a strategy to target amyloid diseases by cooperation with the PQC system exploiting key cellular systems.
Full text 77,139 characters · extracted from preprint-html · click to expand
Fibrilpaint20 directs the ubiquitin–proteasome system to Tau amyloid fibrils | bioRxiv /* */ /* */ <!-- <!-- /*! * yepnope1.5.4 * (c) WTFPL, GPLv2 */ (function(a,b,c){function d(a){return"[object Function]"==o.call(a)}function e(a){return"string"==typeof a}function f(){}function g(a){return!a||"loaded"==a||"complete"==a||"uninitialized"==a}function h(){var a=p.shift();q=1,a?a.t?m(function(){("c"==a.t?B.injectCss:B.injectJs)(a.s,0,a.a,a.x,a.e,1)},0):(a(),h()):q=0}function i(a,c,d,e,f,i,j){function k(b){if(!o&&g(l.readyState)&&(u.r=o=1,!q&&h(),l.onload=l.onreadystatechange=null,b)){"img"!=a&&m(function(){t.removeChild(l)},50);for(var d in y[c])y[c].hasOwnProperty(d)&&y[c][d].onload()}}var j=j||B.errorTimeout,l=b.createElement(a),o=0,r=0,u={t:d,s:c,e:f,a:i,x:j};1===y[c]&&(r=1,y[c]=[]),"object"==a?l.data=c:(l.src=c,l.type=a),l.width=l.height="0",l.onerror=l.onload=l.onreadystatechange=function(){k.call(this,r)},p.splice(e,0,u),"img"!=a&&(r||2===y[c]?(t.insertBefore(l,s?null:n),m(k,j)):y[c].push(l))}function j(a,b,c,d,f){return q=0,b=b||"j",e(a)?i("c"==b?v:u,a,b,this.i++,c,d,f):(p.splice(this.i++,0,a),1==p.length&&h()),this}function k(){var a=B;return a.loader={load:j,i:0},a}var l=b.documentElement,m=a.setTimeout,n=b.getElementsByTagName("script")[0],o={}.toString,p=[],q=0,r="MozAppearance"in l.style,s=r&&!!b.createRange().compareNode,t=s?l:n.parentNode,l=a.opera&&"[object Opera]"==o.call(a.opera),l=!!b.attachEvent&&!l,u=r?"object":l?"script":"img",v=l?"script":u,w=Array.isArray||function(a){return"[object Array]"==o.call(a)},x=[],y={},z={timeout:function(a,b){return b.length&&(a.timeout=b[0]),a}},A,B;B=function(a){function b(a){var a=a.split("!"),b=x.length,c=a.pop(),d=a.length,c={url:c,origUrl:c,prefixes:a},e,f,g;for(f=0;f<d;f++)g=a[f].split("="),(e=z[g.shift()])&&(c=e(c,g));for(f=0;f<b;f++)c=x[f](c);return c}function g(a,e,f,g,h){var i=b(a),j=i.autoCallback;i.url.split(".").pop().split("?").shift(),i.bypass||(e&&(e=d(e)?e:e[a]||e[g]||e[a.split("/").pop().split("?")[0]]),i.instead?i.instead(a,e,f,g,h):(y[i.url]?i.noexec=!0:y[i.url]=1,f.load(i.url,i.forceCSS||!i.forceJS&&"css"==i.url.split(".").pop().split("?").shift()?"c":c,i.noexec,i.attrs,i.timeout),(d(e)||d(j))&&f.load(function(){k(),e&&e(i.origUrl,h,g),j&&j(i.origUrl,h,g),y[i.url]=2})))}function h(a,b){function c(a,c){if(a){if(e(a))c||(j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}),g(a,j,b,0,h);else if(Object(a)===a)for(n in m=function(){var b=0,c;for(c in a)a.hasOwnProperty(c)&&b++;return b}(),a)a.hasOwnProperty(n)&&(!c&&!--m&&(d(j)?j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}:j[n]=function(a){return function(){var b=[].slice.call(arguments);a&&a.apply(this,b),l()}}(k[n])),g(a[n],j,b,n,h))}else!c&&l()}var h=!!a.test,i=a.load||a.both,j=a.callback||f,k=j,l=a.complete||f,m,n;c(h?a.yep:a.nope,!!i),i&&c(i)}var i,j,l=this.yepnope.loader;if(e(a))g(a,0,l,0);else if(w(a))for(i=0;i (function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0];var j=d.createElement(s);var dl=l!='dataLayer'?'&l='+l:'';j.src='//www.googletagmanager.com/gtm.js?id='+i+dl;j.type='text/javascript';j.async=true;f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-M677548'); Skip to main content Home About Submit ALERTS / RSS Search for this keyword Advanced Search New Results Fibrilpaint20 directs the ubiquitin–proteasome system to Tau amyloid fibrils View ORCID Profile Françoise A. Dekker , View ORCID Profile Júlia Aragonès Pedrola , View ORCID Profile Emile van Weert , Anne den Breejen , Laura Peters , Adriana Poza-Rodriguez , View ORCID Profile Guy Mayer , Shalini Singh , View ORCID Profile Alfred C.O. Vertegaal , View ORCID Profile Assaf Friedler , View ORCID Profile Stefan G. D. Rüdiger doi: https://doi.org/10.1101/2024.08.27.609886 Françoise A. Dekker 1 Cellular Protein Chemistry, Bijvoet Center for Biomolecular Research, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands 2 Science for Life, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands 3 Protein Chemistry of Disease, Department of Chemistry, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Françoise A. Dekker Júlia Aragonès Pedrola 1 Cellular Protein Chemistry, Bijvoet Center for Biomolecular Research, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands 2 Science for Life, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands 3 Protein Chemistry of Disease, Department of Chemistry, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Júlia Aragonès Pedrola Emile van Weert 4 Department of Cell and Chemical Biology, Leiden University Medical Center , Leiden, The Netherlands Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Emile van Weert Anne den Breejen 1 Cellular Protein Chemistry, Bijvoet Center for Biomolecular Research, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands 3 Protein Chemistry of Disease, Department of Chemistry, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands Find this author on Google Scholar Find this author on PubMed Search for this author on this site Laura Peters 1 Cellular Protein Chemistry, Bijvoet Center for Biomolecular Research, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands 3 Protein Chemistry of Disease, Department of Chemistry, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands Find this author on Google Scholar Find this author on PubMed Search for this author on this site Adriana Poza-Rodriguez 1 Cellular Protein Chemistry, Bijvoet Center for Biomolecular Research, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands 3 Protein Chemistry of Disease, Department of Chemistry, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands Find this author on Google Scholar Find this author on PubMed Search for this author on this site Guy Mayer 5 Institute of Chemistry, The Hebrew University of Jerusalem, Edmond J. Safra Campus at Givat Ram , Jerusalem 9190401, Israel Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Guy Mayer Shalini Singh 5 Institute of Chemistry, The Hebrew University of Jerusalem, Edmond J. Safra Campus at Givat Ram , Jerusalem 9190401, Israel Find this author on Google Scholar Find this author on PubMed Search for this author on this site Alfred C.O. Vertegaal 4 Department of Cell and Chemical Biology, Leiden University Medical Center , Leiden, The Netherlands Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Alfred C.O. Vertegaal Assaf Friedler 5 Institute of Chemistry, The Hebrew University of Jerusalem, Edmond J. Safra Campus at Givat Ram , Jerusalem 9190401, Israel Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Assaf Friedler Stefan G. D. Rüdiger 1 Cellular Protein Chemistry, Bijvoet Center for Biomolecular Research, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands 2 Science for Life, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands 3 Protein Chemistry of Disease, Department of Chemistry, Utrecht University , Padualaan 8, 3584CH Utrecht, The Netherlands Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Stefan G. D. Rüdiger For correspondence: s.g.d.rudiger{at}uu.nl Abstract Full Text Info/History Metrics Preview PDF Summary Failure of the Protein Quality Control (PQC) System to control the Tau protein leads to amyloid fibrils that are at the basis of various Tauopathies, including Alzheimer’s Disease (AD). Reinstating the PQC for Tau is desirable. Here we show that the PROTAC peptide FibrilPaint20 (FP20) recruits the ubiquitination system to Tau amyloid fibrils. We reconstituted the ubiquitin-proteasome cascade and monitored the stepwise ubiquitin transfer using the microfluidics technique FIDA. To direct ubiquitination specifically to amyloids, we discovered FP20, a bifunctional peptide that connects amyloid fibrils to the E3 ligase CHIP. FP20 mediated ubiquitination of recombinant and patient derived fibrils from various tauopathies, ultimately enabling the 26S proteasome to target CHIP-ubiquitinated Tau fibrils. This shows that FP20 cooperates with the PQC system and can initiate fibril cleavage. This offers a strategy to target amyloid diseases by cooperation with the PQC system exploiting key cellular systems. 1. Introduction The Protein Quality Control (PQC) system controls aggregation-prone proteins in the cell. This system consists of a network of molecular chaperones and degradation machineries tasked with maintaining cellular protein homeostasis 1 – 3 . When the PQC system fails, misfolded proteins accumulate and assemble into amyloid fibrils 4 , 5 . Aggregation of the microtubule-binding protein, Tau, into intracellular amyloid fibrils is a hallmark in Alzheimer’s Disease (AD) and other neurodegenerative tauopathies 6 , 7 . Ultimately, this leads to cognitive decline and motor dysfunction in affected individuals 7 – 9 In healthy neurons, Tau homeostasis is maintained by the main chaperone systems of the cell, Hsp70 and Hsp90 10 – 14 . They bind to Tau and recruit the E3 ligase CHIP, which subsequently ubiquitinates Tau and ultimately leads to degradation by the 26S proteasome 13 , 14 . As long as this cascade functions, Tau cannot form amyloid fibrils. With aging, however, PQC capacity declines, which may facilitate the appearance of amyloids 3 , 15 . This potentially creates ever bigger challenges for PQC due to growing amyloid fibrils in disease. This raises the question what it takes to restore PQC capacity for Tau once fibrils have formed. Although Hsp70 can, in principle, disassemble in vitro -generated Tau fibrils, this process is incomplete 16 – 18 . Thus, the potential of the chaperone machinery to restore cellular protein homeostasis once fibrils have formed is limited. Tau is an intrinsically disordered protein, which makes the binding sites of the Hsp70 and Hsp90 chaperones easily accessible for the chaperone machinery. These binding sites reside in the aggregation-prone microtubule binding repeat region of Tau 19 . During aggregation, these sites may become less accessible for the PQC system 20 – 23 . Interestingly, inclusions in patient brains are frequently decorated with ubiquitin, suggesting that the PQC machinery does attempt to mark these aggregates for proteasomal clearance 24 – 26 . However, fibrils in the brain of AD patients are predominantly monoubiquitinated, which does not suffice for subsequent action. It is poorly understood which step in the ubiquitination cascade breaks down first in disease, and what defines the limits of the degradation machinery. Downstream recruitment systems may not effectively engage fibrillar substrates, either due to poor recognition or too few ubiquitin-binding sites available 27 . Another possibility is that early intermediates of the aggregation pathway may inhibit proteasomal degradation 28 – 30 . Or, end-stage fibrils might simply be too large or too stable for the proteasome to process or for lysosomes to surround the fibril 31 , 32 . To address these questions, it is key to understand whether ubiquitination can in principle target fibrillar substrates and to which extent it may still render fibrils accessible to proteasomal processing. Addressing these questions requires tools that allow direct connection of the ubiquitination machinery to amyloid fibrils. Recently, we discovered FibrilPaint1 (FP1), a fluorescently-labelled Proteolysis Targeting Chimera (PROTAC) peptide that specifically recognises fibrils 33 – 37 . This work exploits the FibrilPaint concept to recruit the ubiquitin– proteasome system (UPS) to Tau fibrils. Here, we introduce the PROTAC FibrilPaint20 (FP20), a non-fluorescent derivative of FP1 that specifically binds amyloid fibrils and recruits CHIP via a C-terminal EEVD motif. FP20 recruited recombinant and patient-derived Tau fibrils to the reconstituted E1-E2-E3 ubiquitin cascade. FIDA technology allowed to follow the stepwise travelling of fluorescently labelled ubiquitin throughout this cascade. The 26S proteasome subsequently recognised and also cleaved growing, recombinant TauRD fibrils. Our findings suggest that amyloid fibrils remain accessible to the UPS, which renders the combination of FP20 and CHIP interesting for initiation-controlled removal of pre-formed Tau fibrils. 2. Results 2.1 FP20 binds to Tau amyloids and CHIP simultaneously We aim to recruit the UPS system to Tau amyloid fibrils, using the specific recognition of Tau fibrils by FibrilPaint peptides, which is established 33 . FP1 also carries a C-terminal EEVD motif, which serves as a recognition sequence for recruitment of the E3 ligase CHIP ( Table S1 ) . We addressed whether FibrilPaints can engage both CHIP and amyloid fibrils simultaneously. We developed two variants of the FibrilPaint family: FP20 (lacking the N-terminal fluorescein) and FP6 (lacking the C-terminal GSGSEEVD motif) ( Table S1 , Fig. 1A ). Download figure Open in new tab Figure 1. FP1 and FP20 promote binding of the E3 ligase CHIP to amyloid fibrils. ( A ) Sequences and structural representations of FP1, FP20, and FP6. FPs are shown as stick models (blue). Residues 1–14, critical for amyloid binding, are highlighted in dark blue; residues 19–22, mediating CHIP binding, are shown in light blue. ( B ) Binding of CHIP to FP1 (green, N=4) detected by microscale thermophoresis (MST), showing a dose–response curve with an apparent affinity of 1.5 µM. FP6 (blue, N=3) did not elicit a response. ( C ) No initial fluorescence shift was observed when up to 10 µM CHIP bound to FP20. ( D ) Initial fluorescence shift of Fl-CHIP upon binding to TauRD amyloid fibrils. Apparent affinities were above 1.1e-6 M in absence and 1.1e-8 M in presence of FP20. We titrated CHIP against FP1 and FP6 and measured binding using microscale thermophoresis (MST), monitoring the thermophoretic response. FP1 showed a dose-dependent response to CHIP, with a binding affinity of 1.5 µM ( Fig 1B ). FP6 showed no detectable response up to 25 µM CHIP, demonstrating the requirement of the GSGSEEVD motif for CHIP recruitment by FP ( Fig 1B ). We investigated whether FP20 can recruit CHIP to Tau fibrils. Fluorescence labelling of CHIP with Atto-565 via an ester reaction (Fl-CHIP) enabled direct detection. The titration of fibrils of the repeat domain of Tau (Tau-RD) into a solution containing Fl-CHIP and FP20 revealed a high affinity of Fl-CHIP to Tau-RD fibrils in the presence of FP20, with a K D of 1.1 × 10⁻⁸ M resulting from MST measurements ( Fig. 1D ). In the absence of FP20, the K D of Fl-CHIP for Tau fibrils was two orders of magnitude lower (K D 1.1 × 10⁻ 6 M ( Fig 1D ). As FP20 does not alter the fluorescence signal upon binding Fl-CHIP ( Fig 1C ), we conclude that FP20 is an effective recruiter of the E3 ligase CHIP for Tau fibrils. 2.1 Flow-based sizing of ubiquitin reveals distinct intermediates of the ubiquitin machinery Next, we monitored the passage of ubiquitin throughout the degradation cascade. Previously, we pioneered the use the FibrilRuler test, combining FP1 and Flow Induced Dispersion Analysis (FIDA), to monitor fibril length via determining the hydrodynamic radius, R h 33 , 38 , 39 . Here, fluorescein-labelled Ubiquitin (Fl-Ub) allows monitoring the attachment of Ub to various proteins and protein complexes. Ub is a small protein with a predicted R h (R h *) of 1.7 nm. If the small Fl-Ub links to another protein, e.g. a Ub-ligase, it results in a larger fluorescent complex, with an increased R h value. We reconstituted the transfer of the Fl-Ub through the E1-E2-E3 ubiquitin cascade and monitored this via size changes in FIDA experiments 40 , 41 ( Table S2 , Fig. 1A ), using UBE1 (E1), UB2K (E2) and CHIP (E3). The structural coordinates of these enzymes enabled the prediction of the expected R h values (with and without ubiquitin), as R h strictly depends on the diffusion properties of the particle, which in turn depends on its dimensions (Table S2) . All components of the cascade differ in size, which allowed monitoring of the handover from one step to the next throughout the cascade in order of addition experiments (R h values of UBE1, 4.4 nm; UB2K, 2.3 nm and CHIP 5.1 nm). The enzymes (500 nM) were sequentially added, while increasing the concentration of the enzyme under investigation to 5 µM, to 10 nM Fl-Ub ( Fig. 1B ). Free Fl-Ub showed an R h of 1.8 nm, in close agreement with the predicted R h * of 1.7 nm (Table S2) . The Ub-activating enzyme UBE1 (E1) bound Fl-Ub by forming a thioester bond between the glycine residue of Fl-Ub and a cysteine residue on E1, which is a high-energy bond, requiring ATP 42 . The R h of Fl-Ub increased to 6.3 nm, consistent with the predicted 5.9 nm of the UBE1-Ub complex. Next, Fl-Ub transferred to the catalytic cysteine residue of Ub-conjugating enzyme E2, UB2K, resulting in an R h of 3.4 nm (R h * 3.0 nm). Subsequent interaction of UB2K with the E3 ligase CHIP further increased the R h to 4.7 nm in agreement with, the predicted R h value for CHIP of 5.1 nm. The slightly lower value may reflect the dynamic nature of CHIP. Importantly, Ub transfer through the cascade was strictly ATP dependent: in the absence of ATP, the observed R h remained at 1.8 nm throughout the order of addition experiment, indicating that Fl-Ub did not associate with any ligases. Thus, monitoring the R h of Fl-Ub suffices to demonstrate the transfer of Fl-Ub throughout this E1-E2-E3 cascade. 2.2 FP20 enhances ubiquitination of synthetic and patient-derived fibrils Conjugation of Fl-Ub onto TauRD fibrils by the E3 ligase CHIP came next. Fl-Ub transferred through the E1–E2–E3 cascade under the previously established conditions, with an additional step at the end: addition of recombinant TauRD fibrils as ubiquitination substrate and FP20 as bispecific compound provided a non-covalent bridge between CHIP and the TauRD fibrils ( Fig 2A ). After the journey of fluorescently-labelled ubiquitin through the entire machinery and ultimately onto the fibrils, the R h increased sharply from 1.8 nm to 42 nm ( Fig. 2C ). This was in agreement with the apparent size of the non-ubiquitinated TauRD fibril in the FibrilRuler test (R h = 44 nm) ( Fig. 2C ) 33 . These data indicate that the E1–E2–E3 cascade ubiquitinates TauRD fibrils when using FP20 as bispecific degrader. Download figure Open in new tab Figure 2. Transfer of ubiquitin over the cascade to TauRD and patient-derived Tau amyloid fibrils. (A) Structural representations of the ubiquitin conjugation pathway targeting Tau fibrils, shown to scale. In the presence of ATP, ubiquitin (Ub) is first activated by an E1 enzyme, then transferred to an E2 conjugating enzyme. The Ub–E2 complex is subsequently recognized by an E3 ligase, which binds the substrate for ubiquitin transfer. FP20 facilitates the recruitment of CHIP to the target substrate of Tau amyloid fibrils. For each reaction product, predicted hydrodynamic radius (Rh*) is given, based on available PDB structures. PDB Structures used: Ub, 1UBQ 43 , E1, 6DC6 44 ; E2, 2BEP 45 ; E3, 2C2L 46 . (B) Measured hydrodynamic radius (Rh) of fluorescently labelled ubiquitin (Fl-Ub) and components of the ubiquitin cascade, in presence or absence of ATP. Ub alone (yellow); Ub bound to E1 (orange); Ub bound to E2 (red); and the Ub–E2–E3 complex (dark red). Rh increased only in presence of ATP. (C) Rh of Fl-Ub measured in the presence of TauRD fibrils, ubiquitination machinery, and FP20. Conditions include TauRD fibrils with FP1 only (purple) 33 , full machinery with FP20 in the presence of ATP (lilac), full machinery with FP20 in the absence of ATP (yellow), full machinery in absence of FP20 (green) and full machinery with FP20 followed by urea treatment (pink). (D-F) Rh of Fl-Ub measured, the full machinery and sonicated TauRD fibrils (D) , fibrils purified from patient brains with Alzheimer’s disease (E) , frontotemporal dementia (F) , and corticobasal degeneration (G) , measured in the absence of ATP (yellow) and presence of ATP (lilac). In absence of ATP, the R h remained 1.8 nm, which corresponds to the size of the free Fl-Ub ( Fig. 2C ). When repeating the experiment in the presence of all components and TauRD but without FP20, the R h remained 1.8 nm as well, indicating that under these conditions FP20 is essential to facilitate the transfer ( Fig. 2C ). The complex of TauRD fibrils and Fl-Ub was stable at 4 M urea, the R h value remained at 42 nm ( Fig. 2C ).This indicates covalent attachment, as urea disrupts most protein–protein interactions while leaving amyloid fibrils intact. We wondered whether this cascade may also ubiquitinate smaller fibrils. Smaller fibrils appear earlier during the aggregation process, and early targeting of amyloids for degradation may be beneficial for maintaining cellular health 47 , 48 . Treatment of TauRD fibrils with a sonicator tip for 30 s resulted in a species with an R h of approximately 10 nm 49 . When adding the E1-E2-E3 cacade, FP20 and ATP, the R h increased slightly to 12 nm, indicating ubiquitination of these smaller fibril species, too ( Fig 2D ). We next examined whether it could also facilitate ubiquitination of patient-derived fibrils. Patient-derived fibrils differ from recombinant fibrils conformationally 50 . Tau fibrils are particularly interesting as various Tauopathies are characterised by distinctive fibril morphologies, such as AD, Frontotemporal Dementia (FTD) and Cortical Basal Degeneration (CBD) 20 , 23 , 48 . In AD, tau aggregates into paired helical and straight filaments, in FTD, into narrow filaments; and in CBD, into Type I and II fibrils 51 – 53 . These conformational differences alter which residues are surface-exposed or buried, potentially leading to distinct susceptibilities to ubiquitination 23 . We extracted Fibrils from patient material for AD, FTD and CBD 33 , 51 – 53 . These fibrils underwent the same treatment for ubiquitination as before, followed by monitoring R h of Fl-Ub. For AD, R h extended to 130 nm in presence of ATP ( Fig. 2E ). For FTD, R h was 68 nm ( Fig. 2F ) and for CBD 80 nm ( Fig. 2G ). Thus, ubiquitination was not limited to recombinant structures but could be extended to patient-derived fibrils. This indicates that neither post-translational modifications characteristic of patient-derived Tau fibrils nor the extended fuzzy coat surrounding the fibril core impede FP20-dependent ubiquitination. 2.3 Dynamic Light Scattering (DLS) to monitor fibril growth Having generated ubiquitinated fibrils, the question remained whether these could be processed by the proteasome. Our previous approach, FIDA, relies on detecting fluorescently labelled ubiquitin, but this would leave a single Fl-Ub readout when the proteasome acts on ubiquitinated fibrils. To directly monitor size changes of fibrils in solution, we therefore turned to dynamic light scattering (DLS). DLS is a widely used method to determine particle size in solution, revealing the cumulant radius as readout for the size of particles. DLS can also be used as a relative measure of aggregate dynamics over time 49 , 54 – 57 . We decided to establish the latter approach for Tau aggregation as the presence of large fibrils tends to dominate DLS signal, making absolute cumulant radii unreliable for heterogeneous solutions. DLS was suitable to monitor TauRD fibril formation over time ( Fig. 3 ). During aggregation, new peaks appeared to the right of the monomer peak, while the relative frequency of the monomer peak decreased ( Fig. 3A, B ). For each sample, a the DLS measurement revealed a size specific profile revealing a relative cumulant value, termed the apparent R h (R h _app). Tracking changes in R h _app indicated whether fibril populations shifted toward more or larger assemblies or smaller species. For example, monomeric Tau showed an R h _app of 4.2 nm ( Fig. 3A ), which increased to 74 nm after 24 h of aggregation ( Fig. 3B ). Download figure Open in new tab Figure 3. Dynamic light scattering (DLS) to monitor fibril growth. (A, B) Representative DLS measurements of TauRD monomers (A) and TauRD amyloid fibrils (B) . Grey line indicated monomeric species, while the purple line marks the emergence of fibrillar species. Each sample is summarised with the hydrodynamic radius (Rh) as a cumulant value, named Rh_app. (C) TauRD aggregation monitored by Thioflavin T (ThT) fluorescence in presence or absence of heparin. (D) Corresponding apparent hydrodynamic radii (Rh_app) measured with DLS over time. (E) Transmission Electron Microscopy (TEM) image of TauRD fibrils after 24 h of aggregation. White bar in the top right corner reflects a scale of 200 nm. We compared the R h _app value obtained by DLS with aggregation monitoring by Thioflavin T (ThT) fluorescence, and Transmission Electron Microscopy (TEM) after 24 h of fibril growth ( Fig. 3C –E ). ThT indicates the presence of the β-sheets formed during aggregation, and the ThT signal rose sharply immediately after the addition of heparin, which triggered the aggregation of TauRD, but not for the condition without heparin ( Fig. 3C ). ThT fluorescence reached a plateau after 4 h. Like ThT, and R h _app showed an immediate increase after the addition of heparin ( Fig. 3D ). Monomers exhibited an R h _app value of 4.2 nm, which rose to approximately 30 nm after 4 h of aggregation and further increased to 47 nm after 24 h. This was consistent with earlier observations that ThT saturation does not always reflect completion of fibril growth 33 , 54 , 58 , 59 . TEM analysis of Tau fibrils at the of end of the aggregation process revealed long, singular fibrils, consistent with the DLS results ( Fig. 3E ). Thus, this DLS approach is suitable to monitor trends in fibril formation. 26S proteasome recognises and cleaves ubiquitinated Tau amyloid fibrils We next tested whether TauRD fibrils can be processed by the 26S proteasome. Polyubiquitination serves as a key degradation signal for both the proteasome and autophagy, with the ubiquitin linkage type determining substrate fate 60 , 61 . The initial setup employed UBE2K (E2-25K), which is suboptimal for our purpose since it specializes in elongating monoubiquitinated substrates 62 , 63 . The replacement of this cascade step with the E2 enzyme E2D1 (UbcH5a), a CHIP partner capable of building K48-linked polyubiquitin, allowed to test whether creation of more extensive ubiquitination enables for recognition by a proteolytic clearance system 64 , 65 . Increasing the incubation times of the ubiquitination reactions thereby enhanced the likelihood for generating proteasome-recognisable polyubiquitin modifications on amyloid fibrils. We added human 26S proteasomes, freshly purified from HEK293 GP2 cells stably expressing hRpn11-HTBH, subsequently to each experimental condition (0.2 nM) 66 . The DLS set-up established for growing TauRD fibrils allowed assessing proteasomal degradation ( Fig. 3A, 3B , 4A ). To that effect, growing TauRD fibril samples 26S proteasomes incubated for 3.5 h, after which we monitored fibril size via determining R h _app. Normalising to the R h _app measured at moment of 26S addition accounted for variability in fibril preparations, such that changes reflect proteasomal activity rather than increased inter-sample heterogeneity ( Fig. 4B ). Remarkably, the presence of the 26S proteasome lowered R h _app of Fl-Ub-labelled Tau fibrils over time ( Fig. 4C ). R h _app decreased from 90 ± 9 nm to 38 ± 14 nm after 3.5 h. Already after 1 h R h _app shrank 2-fold, further increasing to a 2.6-fold reduction after 3.5 h. This demonstrates that the 26S proteasome can recognise the ubiquitin-labelled Tau fibrils and cleave them, resulting in fragments that are considerably bigger than the TauRD monomer. Thus, the reaction did not lead to full degradation of the TauRD fibrils. However, our findings indicate that the proteasome can cleave TauRD fibrils after the FP20-dependent labelling in a reconstituted E1-E2-E3 cascade. Download figure Open in new tab Figure 4. 26S proteasomal degradation of amyloid fibrils. (A) Schematic representation of ubiquitin-labelled Tau amyloid fibrils recognized by the 26S proteasome, followed by fibril degradation and recycling of ubiquitin. The proteasome is blocked by inhibitor MG132. Structures: ubiquitin (PDB: 1UBQ 43 ); fibril based on Tau PHF (PDB: 5O3L 51 ) and 26S proteasome (PDB: 4CR2 67 ). (B, C) Incubation of TauRD fibrils with 26S proteasome in presence (B) or absence (C) of MG132. Data were normalized within to reflect the fold change upon addition of the 26S proteasome (t=0). Shown are average results from two independent experiments. To verify that the degradation activity is specific to the cleavage activity of the 26S proteasome, we did the experiment in parallel in the presence of 50 µM proteasome inhibitor MG132, which we pre-incubated for 10 minutes at 25°C followed by 90 min on ice. In the presence of MG132 and the 26S proteasome, TauRD fibrils showed a time-dependent increase in size, 3.3-fold after 3.5 h ( Fig. 4B ). Size monitored by determining the R h _app value increased from 72 ± 13 nm to 236 ± 46 nm. Considering the 2.6-fold decrease in fibril size in the absence of the proteasome inhibitor and the 3.3-fold increase in its presence, the net effect indicates that proteasomal activity reduced the length of TauRD fibrils by approximately 8.6-fold after 3.5 hours. Thus, the specific activity of the 26S proteasome was key to reduce the size of TauRD fibrils. 3. Discussion Here, we showed that the 26S proteasome is capable of cleaving Tau amyloid fibrils, using FP20 as a PROTAC for targeted degradation. By reconstituting the ubiquitination cascade, we showed that FP20 recruits the E3 ligase CHIP to fibrillar Tau, resulting in covalent ubiquitination. This ubiquitination was sufficient to render Tau fibrils recognisable to the proteasome, leading to their partial degradation. These findings establish that mature amyloid fibrils can be engaged by the ubiquitin–proteasome system. FP20 is a targeted degrader that specifically ubiquitinates Tau amyloid fibrils, both recombinant and patient derived. This distinguishes FP20 from existing Tau targeting strategies, which typically use PET tracer–derived warheads and target total Tau rather than fibrils. Comparable approaches targeting only fibrils are emerging for α-synuclein 68 , 69 . Unlike most Tau degraders that recruit von Hippel–Lindau or Cereblon E3 ligases, FP20 employs CHIP as the E3 ligase, expanding the set of PROTAC E3 ligases 70 , 71 . CHIP is highly relevant to Tau biology, as it polyubiquitinates Tau in cells 72 , contributes to Tau clearance 73 , 74 , and remains present in the brains of Alzheimer’s disease patients 75 . The EEVD motif in FP20 offers modularity and can be easily adapted to other targeting strategies. The recognition motif can be readily fused to other protein constructs, enabling the recruitment of additional PQC factors to amyloid substrates. It is an interesting question what the consequences of proteasomal cleavage of fibrils are for cellular proteostasis. The 26S proteasome shortened fibrils almost by one order or magnitude, but the process was incomplete, suggesting that the proteasome may generate smaller amyloid fragments rather than fully disassembling fibrils. Such fragments may retain or even enhance seeding activity 76 , 77 . In the context of disease, 26S proteasomes may be less capable, as the protein quality control capacity declines over time 3 , 15 , 75 and 26S proteasome function may be impaired 78 , 79 , potentially due to inhibition by early aggregate intermediates 28 , 30 , 80 , 81 . To understand how FP20 directs ubiquitination, we reconstituted the entire ubiquitin– proteasome system in vitro using purified components. This setup allowed us to trace ubiquitin through the cascade onto amyloid substrates, enabling proteasome-mediated cleavage of fibrils. Cell- or animal based targeted degradation experiments have demonstrated beneficial phenotypic outcomes, such as reduced aggregate load and improved cellular health 68 – 71 . However, it remained unclear whether such effects arise directly, through proteasomal engagement with fibrils or inhibition of fibril growth by degradation of monomeric precursors, or indirectly, through alternative routes. By reconstituting the pathway, our work provides mechanistic evidence that mature fibrils themselves can be ubiquitinated and engaged by the proteasome. Thus, this study shows a proof-of-principle that ubiquitin-proteasome system can act on mature amyloid fibrils, not only their soluble precursors. This demonstrates that even highly structured aggregates remain targetable and can be guided by engineered adaptors, such as FP20. These findings open new opportunities for the development of targeted degradation strategies. 4. Materials and Methods Expression and purification of TauRD N-terminally FLAG-tagged (DYKDDDDK) human TauRD (Q244-E372, with pro-aggregation mutation ΔK280) was produced in E. Coli BL21 Rosetta 2 (Novagen), with an additional removable N-terminal His6-Smt-tag (MGHHHHHHGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLME AFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG). Expression was induced at OD600 0.8 by addition of 0.15 mM IPTG and incubation at 18 oC overnight. Cells were harvested by centrifugation, resuspended in 25 mM HEPES-KOH pH 8.5, 50 mM KCl, flash frozen in liquid nitrogen, and kept at – 80 °C until further usage. Pellets were thawed at 37 °C, followed by the addition of ½ tablet/50 ml EDTA-free Protease Inhibitor and 5 mM β-mercaptoethanol. Cells were disrupted using an EmulsiFlex-C5 cell disruptor, and lysate was cleared by centrifugation. Supernatant was filtered using a 0.22 μm polypropylene filtered and purified with an ÄKTA purifier chromatography System. Sample was loaded into a POROS 20MC affinity purification column with 50 mM HEPES-KOH pH 8.5, 50 mM KCl, eluted with a linear gradient 0-100%, 5 CV of 0.5 M imidazole. Fractions of interest were collected, concentrated to 2.5 ml using a buffer concentration column (vivaspin, MWCO 10 kDda), and desalted using PD-10 desalting column to HEPES pH 8.5, ½ tablet/50 ml Complete protease inhibitor, 5 mM β-mercaptoethanol. The His6-Smt-tag was removed by treating the sample with Ulp1, 4 °C, shaking, overnight. The next day, sample was loaded into POROS 20HS column with HEPES pH 8.5, eluted with 0-100% linear gradient, 12 CV of 1M KCl. Fractions of interest were collected and loaded into a Superdex 26/60, 200 pg size exclusion column with 25 mM HEPES-KOH pH 7.5, 75 mM NaCl, 75 mM KCl. Fractions of interest were concentrated using a concentrator (vivaspin, MWCO 5 kDa) to desired concentration. Protein concentration was measured using a NanoDrop™ OneC UV/Vis spectrophotometer and purity was assessed by SDS-PAGE. Protein was aliquoted and stored at – 80 °C. Expression and purification of CHIP E3 ligase CHIP was produced with an additional removable N-Terminal His6-Smt-tag ((MGHHHHHHGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLM EAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG) in E.coli BL21 Rosetta cells. Expression was induced at OD600 0.8 by addition of 0.2 mM IPTG and incubation at 18 °C overnight. Cells were harvested by centrifugation, resuspended in 25mM Na-Pi pH 7.2, 1500 mM NaCl, flash frozen in liquid nitrogen, and kept at – 80 °C until further usage. Pellets were thawed at 37 °C, followed by the addition of ½ tablet/50 ml EDTA-free Protease Inhibitor and 5 mM β-mercaptoethanol. Cells were disrupted using an EmulsiFlex-C5 cell disruptor, and lysate was cleared by centrifugation. Supernatant was filtered using a 0.22 μm polypropylene filtered and purified with an ÄKTA purifier chromatography System. Sample was loaded into a POROS 20MC affinity purification column with 50 mM Na-Pi pH 8.0, 300 mM NaCl, eluted with a linear gradient 0-100%, 5 CV of 0.5 M imidazole. Fractions of interest were collected, concentrated to 2.5 ml using a buffer concentration column (vivaspin, MWCO 10 kDda), and desalted using PD-10 desalting column to 10 mM HEPES-KOH pH 7.2 buffer., ½ tablet/50 ml Complete protease inhibitor, 5 mM β-mercaptoethanol. The His6-Smt-tag was removed by treating the sample with Ulp1, 4 °C, shaking, overnight. The next day, sample was loaded into POROS 20HQ column with 50 mM HEPES pH 7.2, eluted with 0-100% linear gradient, 12 CV of 1M KCl. Fractions of interest were concentrated using a concentrator (vivaspin, MWCO 5 kDda) to desired concentration. Protein concentration was measured using a NanoDrop™ OneC UV/Vis spectrophotometer and purity was assessed by SDS-PAGE. Protein was aliquoted and stored at – 80 °C. Peptide synthesis and purification The peptides were synthesized using a Liberty Blue Microwave-Assisted Peptide Synthesizer (CEM) with standard Fmoc chemistry and Oxyma/DIC as coupling reagents. The peptide concentrations were measured by UV spectroscopy. The peptides were labelled with 5(6)-carboxyfluorescein at their N’ termini. The peptides were cleaved from the resin with a mixture of 95% (v/v) trifluoroacetic acid (TFA), 2.5% (v/v) triisopropylsilane (TIS), 2.5% (v/v) triple distilled water (TDW) agitating vigorously for 3 hours at room temperature. The volume was decreased by N2 flux and the peptides precipitated by addition of 4 volumes of diethylether at −20 °C. The peptides were sedimented at −20 °C for 30 minutes, then centrifuged and the diethylether discarded. The peptides were washed three times with diethylether and dried by gentle N2 flux. The solid was dissolved in 1:2 volume ratio of acetonitrile I:TDW, frozen in liquid Nitrogen and lyophilized. The peptides were purified on a WATERS HPLC using a reverse-phase C18 preparative column with a gradient IACN/TDW. The identity and purity of the peptides was verified by ESI mass spectrometry and Merck Hitachi analytical HPLC using a reverse-phase C8 analytical column. Affinity-based purification of the human 26S proteasome Protocol was adapted from Wang et al. (2007) Biochemistry. HEK 293 GP2 stably expressing hRpn11-HTBHwere grown in DMEM (ThermoFisher, MA, USA) supplemented with 10% FCS (Serana, Pessin, Germany) and 1% Penicillin/Streptomycin (ThermoFisher, MA, USA) to a confluency of 90% in 7 15-cm cell culture dishes per condition. On the day of lysis, the medium was removed, cells were washed with ice-cold PBS and scraped in ice-cold PBS while the dishes were kept on ice. Cells were lysed in 1 ml lysis buffer (50 mM sodium phosphate pH 7.5, 100 mM NaCl, 10% glycerol, 5 mM MgCl2, 0.5% NP-40. 5 mM ATP, 1 mM DTT, and protease inhibitor tablets (Roche, Basel, Switzerland) were added freshly on the same day of use) per condition and spun at 16.000xg at 4°C for 15 minutes. Supernatant was loaded onto 100 μl High Capacity Neutravidin™ Resin (ThermoFisher, MA, USA) that was washed once with lysis buffer and incubated overnight in a cold room while rotating. After incubation the beads were washed twice with lysis buffer and twice with wash buffer (50 mM Tris-HCl pH 7.5, 10% glycerol. 1 mM ATP and protease inhibitor tablets (Roche, Basel, Switzerland) were added freshly on the same day of use). Proteasomes were cleaved off the beads by incubation with 100 μl elution buffer (Per sample: 100 μl wash buffer containing 5 mM ATP, 1 mM DTT, and 3.2 μM TEV protease. ATP, DTT, and TEV protease were added freshly on the same day of use) at 30°C for 1 hour. Beads were separated from the proteasomes by spinning in Durapore® Ultrafree® – MC – HV 0.45 μm PVDF filters (Merck, MA, USA) at 10.000xg for 3 minutes at 4°C. Aliquots of input, unbound, wash, and elution fractions were mixed with 1X Pierce™ LDS Sample Buffer (ThermoFisher, MA, USA) and 100 mM DTT and loaded on NuPAGE™ Bis-Tris 4-12% gradient gels (ThermoFisher, MA, USA) that were run in 1X MOPS buffer. 26S proteasomes that were used for in vitro experiments were not (flash)-frozen beforehand and always used on the same day of measurement. Fibril extraction from human brain Brain material of FTD and CBD were obtained from the Dutch Brain Bank, project number 1369. Brain material of AD was donated by prof. J. J. M. Hoozemans from the VU Medical Centra Amsterdam. PHFs and SFs were extracted from grey matter of prefrontal cortex from one patient diagnosed with AD according to established protocols 51 . Tissue was homogenized using a Polytron(PT 2500E, Kinematica AG) on max speed in 20 % (w/v) A68 buffer, consisting of 20 mM TRIS-HCl pH 7.4, 10 mM EDTA, 1.6 M NaCl, 10% sucrose, 1 tablet/10 ml Pierce protease inhibitor, 1 tablet/10 ml phosphatase inhibitor. The homogenized sample was spun for 20 minutes, at 14000 rpm at 4 °C. Supernatant was collected, and the pellet was homogenized in 10% (w/v) A68 buffer. The homogenized sample was spun once more. The supernatants of both centrifugations were combined and supplied with 10% w/v Sarkosyl, and incubated for 1 hour on a rocker at room temperature. The sample was ultracentrifuged for 1 hour at 100000xg and 4 °C. The supernatant was discarded, and the pellet was incubated overnight at 4 °C in 20 μl/0.2 g starting material of 50 mM TRIS-HCl pH 7.4. The next day, the pellet was diluted up to 1 ml of A68 buffer, and resuspended. To get rid of contamination, the sample was spun for 30 minutes at 14000 rpm, 4 °C. Supernatant was collected and spun once more for 1 hour at 100000xg, 4 °C. The pellet was resuspended in 30 μl 25 mM HEPES-KOH pH 7.4, 75 mM KCl, 75 mM NaCl, and stored at 4 °C up to a month. Presence of PHF and SF was assessed by TEM. Narrow filaments were extracted from the grey matter of the middle frontal gyrus from one patient diagnosed with FTD (nhb 2017-019), as described in established protocols 52 . Fibrils were extracted following the protocol for AD fibrils. After the first ultracentrifugation step, the pellet was resuspended in 250 μl/1g of starting material of 50 mM Tris pH 7.5, 150 mM NaCl, 0.02% amphipol A8-35. The sample was centrifuged for 30 minutes at 3000xg and 4 °C. Pellet was discarded, and the supernatant was ultracentrifuged for 1 hour at 100000xg and 4 °C. The pellet was resuspended in 30 μl of 50 mM TRIS-HCl pH 7.4, 150 mM NaCl, and stored at 4 °C up to a month. Presence of narrow filaments was assessed by TEM. CBD fibrils were extracted from the grey matter of the superior parietal gyrus of one patient diagnosed with CBD (nhb 2018-007), following established protocols 53 . Tissue was homogenized using a Polytron(PT 2500E, Kinematica AG) on max speed in 20 % w/v 10 mM TRIS-HCl pH 7.5, 1 mM EGTA, 0.8 M NaCl, 10% sucrose. The homogenate was supplied with 2% w/v of sarkosyl and incubated for 20 minutes at 37 °C. The sample was centrifuged for 10 minutes at 20000xg, and 25 °C. The supernatant was ultracentrifuged for 20 minutes at 100000xg and 25 °C. The pellet was resuspended in 750 μl/1g starting material of 10 mM TRIS-HCl pH 7.5, 1 mM EGTA, 0.8 M NaCl, 10% sucrose, and centrifuged at 9800xg for 20 minutes. The supernatant was ultracentrifuged for 1 hour at 100000xg. The pellet was resuspended in 25 μl/g starting material of 20 mM TRIS-HCl pH 7.4, 100 mM NaCl, and stored at 4 °C up to a month. Presence of CBD fibrils was assessed by TEM. TauRD fibril formation Aggregation of 20 µM TauRD in 25 mM HEPES-KOH pH 7.4, 75 mM KCl, 75 mM NaCl, ½ tablet/50 ml Protease Inhibitor, was induced by the addition of 5 µM heparin low molecular weight. Aggregation reaction was performed using a thermoshaker 37 °C and 600 rpm during 24 hours. For the Thioflavin T (ThT) Assay, reaction was performed in presence of 35 µM ThT and monitored using a ClarioStar Plus at wavelength (440/485 nm) every 5 minutes after 1 minute shaking at 600 rpm. Thermophoretic response - Microscale thermophoresis binding assay Binding between FP1 or FP6 and CHIP was analysed using Monolith (NanoTemper Technologies) Microscale thermophoresis system (MST). Thermophoresis was monitored at a concentration of 50 nM of FP and a dilution series of CHIP, in 25 mM HEPES-KOH pH 7.5, 75 mM KCl, 75 mM NaCl. Samples were transferred to premium capillaries (NanoTemper Technologies) and measurements were performed at 37 °C, with medium blue LED power and at MST infrared laser power of 50% to induce thermophoretic motion. The infrared laser was switched on 1 s after the start of the measurement for a 20 s period. Datapoints used were the MST response at 5 seconds. Ligand-induced fluorescence change - Microscale thermophoresis binding assay CHIP protein was labelled with Alexa Fluor 594 dye through an NHS-esther reaction. Labelling efficiency was determined to be 80 %. Initial fluorescence change was evaluated using Monolith (NanoTemper Technologies) Microscale thermophoresis system (MST) after transfer of the samples to premium capillaries (NanoTemper Technologies). Measurements were performed at 37 °C, with medium blue LED power and at MST infrared laser. First, FP20 was titrated in as a dilution series from 10 -5 M to a final concentration of 10 -8 M in presence of 20 nM Fl-CHIP. Then, premade amyloids, as described in former sections, were titrated in to 20 nM Fl-CHIP. Maximum fluorescent shift was normalised to 100% as a reference. Next, the same experiments were repeated in presence of 1 µM FP20. Ubiquitin Transfer over the ubiquitin cascade Fluorescein-labeled ubiquitin (Fl-Ub, 10 nM) was sequentially transferred through the ubiquitination cascade (500 nM for E1 (UBE1, Sigma Aldrich), E2 (UBE2K or E2D1, Sigma Aldrich) or E3 (CHIP, purified as described above)) in ubiquitination buffer (40 mM Tris, pH 8.0, 5 mM MgCl₂, 0.05% Tween-20, and 1 mM DTT) in the presence or absence of 5 mM ATP. For each transfer step, the receiving enzyme was added at a 10-fold higher concentration (5 µM) to promote complex formation with Fl-Ub. Reactions were incubated for 1 h at 30 °C. Ubiquitination was assessed on a FIDA1 instrument (480 nm excitation). FIDA1 measurements were performed in capillary dissociation (Capdis) mode and measurement was done at 25 °C. Per run, capillary was cleaned with 1 M NaOH at 3500 mbar for 45 s and equilibrated with buffer (25 mM HEPES, 75 mM KCl, 75mM NaCl, 0.5% pluronic) for 75 s. Sample was injected at 50 mbar for 10 s, and subsequently diffused in buffer at 400 mbar for 300 s. Ubiquitination of amyloid fibrils For ubiquitination of amyloid fibrils, the same ubiquitination reaction was used as described before, together with 500 nM FP20 and the equivalent of 5 μM fibrils. Reactions were carried out in the presence or absence of 5 mM ATP and incubated for 1 h at 30 °C. FIDA measurements were performed as described before, only the last stap, diffusion in buffer, was done under 75 mbar for 1800 s. 26S proteasome cleavage of amyloid fibrils Ubiquitination reactions were performed as described before. To extend chain formation, UBE2K was replaced with E2D1 (UbcH5a, 500 nM) and reactions were incubated overnight at 30 °C to enhance polyubiquitin chain formation. Human 26S proteasomes were freshly purified from HEK293 GP2 cells and added at 15 µg per reaction in absence or presence of 50 µM MG132. Degradation assays were carried out by incubating ubiquitin-labeled TauRD fibrils with proteasomes for 3.5 h at 30 °C. Proteasomal activity was assessed by dynamic light scattering (DLS) at t=0h, t=1h, t=2h and t=3.5h. To account for variation in fibril preparations, apparent hydrodynamic radii (R h _app) were normalized to values measured at the time of proteasome addition using GraphPad Prism (v10.4.1). 5. Conflict of interest JAP, FAD, GM, AF and SGDR are named as inventors in a patent (EP23194706, ‘Peptides for the detection of amyloid fibril Aggregates’) filed by Universiteit Utrecht Holding BV describing the peptides mentioned in this manuscript. The other authors declare no competing interests. 6. Author contributions Conception FAD, JAP, SGDR Design of the work FAD, JAP, ACOV, SGDR Acquisition FAD, JAP, EW, AB, LP, APR, GM, SS, Analysis FAD, JAP, EW Interpretation of data FAD, JAP, SGDR Writing original draft FAD Revision FAD, SGDR, AF, ACOV 7. Supplementary material View this table: View inline View popup Download powerpoint Table S1 FibrilPaint peptides with corresponding sequences, molecular weight (MW) and predicted Rh (Rh*). Amino acids are coloured as hydrophobic, yellow; positive charge, blue; negative charge, red 82 . View this table: View inline View popup Download powerpoint Table S2: Used proteins and peptides, used PDB file, predicted hydrodynamic radii (Rh*) and measured hydrodynamic radii (Rh). Predictions are based on the PDB file and BioFIDA software Rh predictor. Unavailable structures indicated with n.a. (not applicable). Acknowledgements HEK293 GP2 stably expressing hRpn11-HTBH were kindly provided by the Lan Huang lab, at the UC Irvine School of Medicine. AF thanks The Minerva Center for Bio-Hybrid complex systems and the Saerree K. and Louis P. Fiedler Chair in Chemistry. Measurements on the FIDA1, CLARIOstar® Plus and Monolith were done at the Protein Research Centre of Utrecht University. SGDR was supported by grants of the Campaign Team Huntington and Alzheimer Nederland (No. WE.03-2019-03) and a ZonMW TOP grant (No. 91215084). SGDR and ACOV were supported by the Gravitation Consortium “FLOW” (024.006.036), funded by the Dutch Ministry of Education, Culture, and Science (OCW). FAD and SGDR were supported by NWO TakeOff1 (22073) and BioTech Booster (BIOB25014) grants. Funder Information Declared Alzheimer Nederland, https://ror.org/03cw2h814 , WE.03-2019-03 Campaign Team Huntington , Senior grant Ministry of Education Culture and Science, https://ror.org/02x3w5g21 , Gravitation Consortium M-BM-^SFLOWM-BM-^T (024.006.036) ZonMw, The Dutch Organisation for knowledge and innovation in health, healthcare and well-being, https://ror.org/01yaj9a77 , 91215084 Dutch Research Council, https://ror.org/04jsz6e67 , TakeOff1 (22073) Nederlands ministry of economics Footnotes Adding new data on the proteasome interaction with ubiquitinated Tau fibrils, and strengthening the focus on Tau throughout the manuscript. References 1. ↵ Bukau , B. , Weissman , J. , and Horwich , A . ( 2006 ). Molecular chaperones and protein quality control . Cell 125 , 443 – 451 . doi: 10.1016/j.cell.2006.04.014 . OpenUrl CrossRef PubMed Web of Science 2. Balch , W.E. , Morimoto , R.I. , Dillin , A. , and Kelly , J.W . ( 2008 ). Adapting proteostasis for disease intervention . Science (New York, N.Y.) 319 , 916 – 919 . doi: 10.1126/science.1141448 . OpenUrl Abstract / FREE Full Text 3. ↵ Labbadia , J. , and Morimoto , R.I . ( 2015 ). The biology of proteostasis in aging and disease . Annu. Rev. Biochem . 84 , 435 – 464 . doi: 10.1146/annurev-biochem-060614-033955 . OpenUrl CrossRef PubMed 4. ↵ Koopman , M.B. , Ferrari , L. , and Rüdiger , S.G.D . ( 2022 ). How do protein aggregates escape quality control in neurodegeneration? Trends Neurosci . 45 , 257 – 271 . S0166-2236(22)00018-2 [pii]. OpenUrl CrossRef PubMed 5. ↵ Lackie , R.E. , Maciejewski , A. , Ostapchenko , V.G. , Marques-Lopes , J. , Choy , W.Y. , Duennwald , M.L. , Prado , V.F. , and Prado , M.A.M . ( 2017 ). The Hsp70/Hsp90 chaperone machinery in neurodegenerative diseases . Frontiers in Neuroscience 11 , 254 . doi: 10.3389/fnins.2017.00254 . OpenUrl CrossRef PubMed 6. ↵ Scheltens , P. , De Strooper , B. , Kivipelto , M. , Holstege , H. , Chételat , G. , Teunissen , C.E. , Cummings , J. , and van der Flier , W.M. ( 2021 ). Alzheimer’s disease . The Lancet 397 , 1577 – 1590 . OpenUrl CrossRef 7. ↵ Lee , V.M. , Goedert , M. , and Trojanowski , J.Q . ( 2001 ). Neurodegenerative tauopathies . Annu. Rev. Neurosci . 24 , 1121 – 1159 . doi: 10.1146/annurev.neuro.24.1.1121 . OpenUrl CrossRef PubMed Web of Science 8. Dugger , B.N. , and Dickson , D.W . ( 2017 ). Pathology of Neurodegenerative Diseases . Cold Spring Harb. Perspect. Biol . 9 , a028035 . doi: 10.1101/cshperspect.a028035 . OpenUrl Abstract / FREE Full Text 9. ↵ Arendt , T. , Stieler , J.T. , and Holzer , M . ( 2016 ). Tau and tauopathies . Brain Res. Bull . 126 , 238 – 292 . S0361-9230(16)30232-5 [pii]. OpenUrl CrossRef PubMed 10. ↵ Kundel , F. , De , S. , Flagmeier , P. , Horrocks , M.H. , Kjaergaard , M. , Shammas , S.L. , Jackson , S.E. , Dobson , C.M. , and Klenerman , D . ( 2018 ). Hsp70 Inhibits the Nucleation and Elongation of Tau and Sequesters Tau Aggregates with High Affinity . ACS Chem. Bio . 13 , 636 – 646 . doi: 10.1021/acschembio.7b01039 . OpenUrl CrossRef PubMed 11. Thompson , A.D. , Scaglione , K.M. , Prensner , J. , Gillies , A.T. , Chinnaiyan , A. , Paulson , H.L. , Jinwal , U.K. , Dickey , C.A. , and Gestwicki , J.E . ( 2012 ). Analysis of the tau-associated proteome reveals that exchange of Hsp70 for Hsp90 is involved in tau degradation . ACS Chem. Bio . 7 , 1677 – 1686 . doi: 10.1021/cb3002599 . OpenUrl CrossRef PubMed 12. Ferrari , L. , Stucchi , R. , Konstantoulea , K. , van de Kamp , G. , Kos , R. , Geerts , W.J.C. , van Bezouwen , L.S. , Förster , F.G. , Altelaar , M. , Hoogenraad , C.C. , and Rüdigers , S.G.D. ( 2020 ). Arginine pi-stacking drives binding to fibrils of the Alzheimer protein Tau . Nat. Commun . 11 , 571 – 577 . doi: 10.1038/s41467-019-13745-7 . OpenUrl CrossRef PubMed 13. ↵ Sahara , N. , Murayama , M. , Mizoroki , T. , Urushitani , M. , Imai , Y. , Takahashi , R. , Murata , S. , Tanaka , K. , and Takashima , A . ( 2005 ). In vivo evidence of CHIP up-regulation attenuating tau aggregation . J. Neurochem . 94 , 1254 – 1263 . JNC3272 [pii]. OpenUrl CrossRef PubMed Web of Science 14. ↵ Petrucelli , L. , Dickson , D. , Kehoe , K. , Taylor , J. , Snyder , H. , Grover , A. , De Lucia , M. , McGowan , E. , Lewis , J. , Prihar , G. , et al. ( 2004 ). CHIP and Hsp70 regulate tau ubiquitination, degradation and aggregation . Hum. Mol. Genet . 13 , 703 – 714 . doi: 10.1093/hmg/ddh083 . OpenUrl CrossRef PubMed Web of Science 15. ↵ Hipp , M.S. , Kasturi , P. , and Hartl , F.U . ( 2019 ). The proteostasis network and its decline in ageing . Nat. Rev. Mol. Cell Biol . 20 , 421 – 435 . doi: 10.1038/s41580-019-0101-y . OpenUrl CrossRef PubMed 16. ↵ Wentink , A.S. , Nillegoda , N.B. , Feufel , J. , Ubartaitė , G. , Schneider , C.P. , De Los Rios , P. , Hennig , J. , Barducci , A. , and Bukau , B. ( 2020 ). Molecular dissection of amyloid disaggregation by human HSP70 . Nature 587 , 483 – 488 . doi: 10.1038/s41586-020-2904-6 . OpenUrl CrossRef PubMed 17. Nachman , E. , Wentink , A.S. , Madiona , K. , Bousset , L. , Katsinelos , T. , Allinson , K. , Kampinga , H. , McEwan , W.A. , Jahn , T.R. , Melki , R. , et al. ( 2020 ). Disassembly of Tau fibrils by the human Hsp70 disaggregation machinery generates small seeding-competent species . J. Biol. Chem. jbc.RA 120 . 013478 [pii]. OpenUrl 18. ↵ Ferrari , L. , Geerts , W.J.C. , van Wezel , M. , Kos , R. , Konstantoulea , A. , van Bezouwen , L.S. , Förster , F.G. , and Rüdiger , S.G.D. ( 2018 ). Human chaperones untangle fibrils of the Alzheimer protein Tau . BioRxiv . doi: 10.1101/426650 . OpenUrl Abstract / FREE Full Text 19. ↵ Karagöz , G.E. , Duarte , A.M.S. , Akoury , E. , Ippel , H. , Biernat , J. , Morán Luengo , T. , Radli , M. , Didenko , T. , Nordhues , B.A. , Veprintsev , D.B. , et al. ( 2014 ). Hsp90-Tau complex reveals molecular basis for specificity in chaperone action . Cell 156 , 963 – 974 . OpenUrl CrossRef PubMed 20. ↵ Scheres , S.H. , and Goedert , M . ( 2023 ). Molecular pathology of neurodegenerative diseases by cryo-EM of amyloids . Nature 621 ( 7980 ) , 701 – 710 . doi: 10.1038/s41586-023-06437-2 . OpenUrl CrossRef PubMed 21. Koo , E.H. , Lansbury , P.T. , and Kelly , J.W . ( 1999 ). Amyloid diseases: Abnormal protein aggregation in neurodegeneration . Proceedings of the National Academy of Sciences 96 , 9989 – 9990 . doi: 10.1073/pnas.96.18.9989 . OpenUrl FREE Full Text 22. Wilcock , G.K. , and Esiri , M.M . ( 1982 ). Plaques, tangles and dementia. A quantitative study . J. Neurol. Sci . 56 , 343 – 356 . 0022-510X(82)90155-1 [pii]. OpenUrl CrossRef PubMed Web of Science 23. ↵ Shi , Y. , Zhang , W. , Yang , Y. , Murzin , A.G. , Falcon , B. , Kotecha , A. , van Beers , M. , Tarutani , A. , Kametani , F. , Garringer , H.J. , et al. ( 2021 ). Structure-based classification of tauopathies . Nature 598 , 359 – 363 . doi: 10.1038/s41586-021-03911-7 . OpenUrl CrossRef 24. ↵ Mori , H. , Kondo , J. , and Ihara , Y . ( 1987 ). Ubiquitin is a component of paired helical filaments in Alzheimer’s disease . Science 235 , 1641 – 1644 . OpenUrl Abstract / FREE Full Text 25. Le Guerroué , F. , and Youle , R.J. ( 2021 ). Ubiquitin signaling in neurodegenerative diseases: an autophagy and proteasome perspective . Cell Death & Differentiation 28 , 439 – 454 . doi: 10.1038/s41418-020-00667-x . OpenUrl CrossRef PubMed 26. ↵ Abreha , M.H. , Dammer , E.B. , Ping , L. , Zhang , T. , Duong , D.M. , Gearing , M. , Lah , J.J. , Levey , A.I. , and Seyfried , N.T . ( 2018 ). Quantitative analysis of the brain ubiquitylome in Alzheimer’s disease . Proteomics 18 , 1800108 . OpenUrl CrossRef 27. ↵ Ferrari , L. , Bauer , B. , Qiu , Y. , Schuschnig , M. , Klotz , S. , Anrather , D. , Juretschke , T. , Beli , P. , Gelpi , E. , and Martens , S . ( 2024 ). Tau fibrils evade autophagy by excessive p62 coating and TAX1BP1 exclusion . Science Advances 10 , eadm8449 . OpenUrl PubMed 28. ↵ Thibaudeau , T.A. , Anderson , R.T. , and Smith , D.M . ( 2018 ). A common mechanism of proteasome impairment by neurodegenerative disease-associated oligomers . Nat. Commun . 9 , 1097 – 1090 . doi: 10.1038/s41467-018-03509-0 . OpenUrl CrossRef PubMed 29. Myeku , N. , Clelland , C.L. , Emrani , S. , Kukushkin , N.V. , Yu , W.H. , Goldberg , A.L. , and Duff , K.E . ( 2016 ). Tau-driven 26S proteasome impairment and cognitive dysfunction can be prevented early in disease by activating cAMP-PKA signaling . Nat. Med . 22 , 46 – 53 . doi: 10.1038/nm.4011 . OpenUrl CrossRef PubMed 30. ↵ Bence , N.F. , Sampat , R.M. , and Kopito , R.R . ( 2001 ). Impairment of the ubiquitin-proteasome system by protein aggregation. Science (New York , N.Y .) 292 , 1552 – 1555 . doi: 10.1126/science.292.5521.1552 . OpenUrl Abstract / FREE Full Text 31. ↵ Finley , D . ( 2009 ). Recognition and processing of ubiquitin-protein conjugates by the proteasome . Annu. Rev. Biochem . 78 , 477 – 513 . doi: 10.1146/annurev.biochem.78.081507.101607 . OpenUrl CrossRef PubMed Web of Science 32. ↵ Zhao , D.Y. , Bäuerlein , F.J.B. , Saha , I. , Hartl , F.U. , Baumeister , W. , and Wilfling , F . ( 2024 ). Autophagy preferentially degrades non-fibrillar polyQ aggregates . Mol. Cell 84 , 1980 – 1994 .e1988. doi: 10.1016/j.molcel.2024.04.018 . OpenUrl CrossRef PubMed 33. ↵ Aragonès Pedrola , J. , Dekker , F.A. , Garfagnini , T. , Mayer , G. , Koopman , M.B. , Bergmeijer , M. , Heesink , G. , Rots , I. , Claessens , M.M.A.E. , Förster , F. , et al. ( 2025 ). FibrilPaint to determine the length of Tau amyloids in fluids . Proceedings of the National Academy of Sciences . doi: 10.1101/2023.10.13.562220 . OpenUrl CrossRef 34. Wang , Y. , Jiang , X. , Feng , F. , Liu , W. , and Sun , H . ( 2020 ). Degradation of proteins by PROTACs and other strategies . Acta pharmaceutica Sinica.B 10 , 207 – 238 . doi: 10.1016/j.apsb.2019.08.001 . OpenUrl CrossRef PubMed 35. Hanzl , A. , and Winter , G.E . ( 2020 ). Targeted protein degradation: current and future challenges . Curr. Opin. Chem. Biol . 56 , 35 – 41 . S1367-5931(19)30139-5 [pii]. OpenUrl CrossRef PubMed 36. Scheepstra , M. , Hekking , K.F.W. , van Hijfte , L. , and Folmer , R.H.A. ( 2019 ). Bivalent Ligands for Protein Degradation in Drug Discovery . Computational and structural biotechnology journal 17 , 160 – 176 . doi: 10.1016/j.csbj.2019.01.006 . OpenUrl CrossRef PubMed 37. ↵ Sakamoto , K.M. , Kim , K.B. , Kumagai , A. , Mercurio , F. , Crews , C.M. , and Deshaies , R.J . ( 2001 ). Protacs: chimeric molecules that target proteins to the Skp1-Cullin-F box complex for ubiquitination and degradation . Proceedings of the National Academy of Sciences of the United States of America 98 , 8554 – 8559 . 141230798 [pii]. OpenUrl Abstract / FREE Full Text 38. ↵ Jensen , H. , and Østergaard , J . ( 2010 ). Flow induced dispersion analysis quantifies noncovalent interactions in nanoliter samples . JACS 132 , 4070 – 4071 . doi: 10.1021/ja100484d . OpenUrl CrossRef PubMed 39. ↵ Pedersen , M.E. , Østergaard , J. , and Jensen , H. ( 2019 ). Flow-Induced Dispersion Analysis (FIDA) for Protein Quantification and Characterization. In Clinical Applications of Capillary Electrophoresis: Methods and Protocols, T.M. Phillips, ed. (Springer New York) , pp. 109 – 123 . doi: 10.1007/978-1-4939-9213-3_8 . OpenUrl CrossRef PubMed 40. ↵ Lowe , J. , Blanchard , A. , Morrell , K. , Lennox , G. , Reynolds , L. , Billett , M. , Landon , M. , and Mayer , R.J . ( 1988 ). Ubiquitin is a common factor in intermediate filament inclusion bodies of diverse type in man, including those of Parkinson’s disease, Pick’s disease, and Alzheimer’s disease, as well as Rosenthal fibres in cerebellar astrocytomas, cytoplasmic bodies in muscle, and mallory bodies in alcoholic liver disease . The Journal of pathology 155 , 9 – 15 . doi: 10.1002/path.1711550105 . OpenUrl CrossRef PubMed Web of Science 41. ↵ Pilon , A. , Yost , P. , Chase , T.E. , Lohnas , G. , Burkett , T. , Roberts , S. , and Bentley , W.E . ( 1997 ). Ubiquitin fusion technology: bioprocessing of peptides . Biotechnology progress 13 , 374 – 379 . doi: 10.1021/bp970040f . OpenUrl CrossRef PubMed 42. ↵ Zheng , N. , and Shabek , N . ( 2017 ). Ubiquitin Ligases: Structure, Function, and Regulation . Annu. Rev. Biochem . 86 , 129 – 157 . doi: 10.1146/annurev-biochem-060815-014922 . OpenUrl CrossRef PubMed 43. ↵ Vijay-Kumar , S. , Bugg , C.E. , and Cook , W.J . ( 1987 ). Structure of ubiquitin refined at 1.8 A resolution . J. Mol. Biol . 194 , 531 – 544 . doi: 10.1016/0022-2836(87)90679-6 . OpenUrl CrossRef PubMed Web of Science 44. ↵ Lv , Z. , Williams , K.M. , Yuan , L. , Atkison , J.H. , and Olsen , S.K . ( 2018 ). Crystal structure of a human ubiquitin E1-ubiquitin complex reveals conserved functional elements essential for activity . J. Biol. Chem . 293 , 18337 – 18352 . doi: 10.1074/jbc.RA118.003975 . OpenUrl Abstract / FREE Full Text 45. ↵ Pichler , A. , Knipscheer , P. , Oberhofer , E. , van Dijk , W.J. , Körner , R. , Olsen , J.V. , Jentsch , S. , Melchior , F. , and Sixma , T.K. ( 2005 ). SUMO modification of the ubiquitin-conjugating enzyme E2-25K . Nat. Struct. Mol. Biol . 12 , 264 – 269 . doi: 10.1038/nsmb903 . OpenUrl CrossRef PubMed Web of Science 46. ↵ Zhang , M. , Windheim , M. , Roe , S.M. , Peggie , M. , Cohen , P. , Prodromou , C. , and Pearl , L.H . ( 2005 ). Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex . Mol. Cell 20 , 525 – 538 . doi: 10.1016/j.molcel.2005.09.023 . OpenUrl CrossRef PubMed Web of Science 47. ↵ Nirmalraj , P.N. , Schneider , T. , Lüder , L. , and Felbecker , A . ( 2023 ). Protein fibril length in cerebrospinal fluid is increased in Alzheimer’s disease . Communications Biology 6 . doi: 10.1038/s42003-023-04606-7 . OpenUrl CrossRef 48. ↵ Lövestam , S. , Li , D. , Wagstaff , J.L. , Kotecha , A. , Kimanius , D. , McLaughlin , S.H. , Murzin , A.G. , Freund , S.M. , Goedert , M. , and Scheres , S.H . ( 2024 ). Disease-specific tau filaments assemble via polymorphic intermediates . Nature 625 ( 7993 ) , 119 – 125 . OpenUrl CrossRef PubMed 49. ↵ Aragonès Pedrola , J. , Todorovska , M. , Singh , S. , Friedler , A. , and Rüdiger , S.G.D. ( 2024 ). Fibril fragmentation generates diversity in seed population . BioRxiv, 2024.2011.2012.623277. doi: 10.1101/2024.11.12.623277 . OpenUrl Abstract / FREE Full Text 50. ↵ Zhang , W. , Falcon , B. , Murzin , A.G. , Fan , J. , Crowther , R.A. , Goedert , M. , and Scheres , S.H . ( 2019 ). Heparin-induced tau filaments are polymorphic and differ from those in Alzheimer’s and Pick’s diseases . eLife 8 , doi: 10.7554/eLife.43584 . OpenUrl CrossRef PubMed 51. ↵ Fitzpatrick , A.W.P. , Falcon , B. , He , S. , Murzin , A.G. , Murshudov , G. , Garringer , H.J. , Crowther , R.A. , Ghetti , B. , Goedert , M. , and Scheres , S.H.W . ( 2017 ). Cryo-EM structures of tau filaments from Alzheimer’s disease . Nature 547 , 185 – 190 . doi: 10.1038/nature23002 . OpenUrl CrossRef PubMed 52. ↵ Falcon , B. , Zhang , W. , Murzin , A.G. , Murshudov , G. , Garringer , H.J. , Vidal , R. , Crowther , R.A. , Ghetti , B. , Scheres , S.H.W. , and Goedert , M . ( 2018 ). Structures of filaments from Pick’s disease reveal a novel tau protein fold . Nature 561 , 137 – 140 . doi: 10.1038/s41586-018-0454-y . OpenUrl CrossRef PubMed 53. ↵ Zhang , W. , Tarutani , A. , Newell , K.L. , Murzin , A.G. , Matsubara , T. , Falcon , B. , Vidal , R. , Garringer , H.J. , Shi , Y. , Ikeuchi , T. , et al. ( 2020 ). Novel tau filament fold in corticobasal degeneration . Nature 580 , 283 – 287 . doi: 10.1038/s41586-020-2043-0 . OpenUrl CrossRef PubMed 54. ↵ Streets , A.M. , Sourigues , Y. , Kopito , R.R. , Melki , R. , and Quake , S.R . ( 2013 ). Simultaneous measurement of amyloid fibril formation by dynamic light scattering and fluorescence reveals complex aggregation kinetics . PLoS One 8 , e54541 . doi: 10.1371/journal.pone.0054541 . OpenUrl CrossRef PubMed 55. Li , Y. , Lubchenko , V. , and Vekilov , P.G . ( 2011 ). The use of dynamic light scattering and brownian microscopy to characterize protein aggregation . Rev. Sci. Instrum . 82 , 053106 . doi: 10.1063/1.3592581 . OpenUrl CrossRef PubMed 56. Velichko , E. , Makarov , S. , Nepomnyashchaya , E. , and Dong , G . ( 2020 ). Molecular Aggregation in Immune System Activation Studied by Dynamic Light Scattering . Biology (Basel ) 9 . doi: 10.3390/biology9060123 . OpenUrl CrossRef 57. ↵ Sokolov , P.A. , Rolich , V.I. , Vezo , O.S. , Belousov , M.V. , Bondarev , S.A. , Zhouravleva , G.A. , and Kasyanenko , N.A . ( 2022 ). Amyloid fibril length distribution from dynamic light scattering data . Eur. Biophys. J . 51 , 325 – 333 . doi: 10.1007/s00249-022-01600-5 . OpenUrl CrossRef PubMed 58. ↵ Sidhu , A. , Vaneyck , J. , Blum , C. , Segers-Nolten , I. , and Subramaniam , V . ( 2018 ). Polymorph-specific distribution of binding sites determines thioflavin-T fluorescence intensity in α-synuclein fibrils . Amyloid 25 , 189 – 196 . doi: 10.1080/13506129.2018.1517736 . OpenUrl CrossRef PubMed 59. ↵ Gade Malmos , K. , Blancas-Mejia , L.M. , Weber , B. , Buchner , J. , Ramirez-Alvarado , M. , Naiki , H. , and Otzen , D. ( 2017 ). ThT 101: a primer on the use of thioflavin T to investigate amyloid formation . Amyloid 24 , 1 – 16 . doi: 10.1080/13506129.2017.1304905 . OpenUrl CrossRef PubMed 60. ↵ Dikic , I . ( 2017 ). Proteasomal and Autophagic Degradation Systems . Annu. Rev. Biochem . 86 , 193 – 224 . doi: 10.1146/annurev-biochem-061516-044908 . OpenUrl CrossRef PubMed 61. ↵ Dikic , I . ( 2017 ). Proteasomal and autophagic degradation systems . Annu. Rev. Biochem . 86 , 193 – 224 . doi: 10.1146/annurev-biochem-061516-044908 . OpenUrl CrossRef PubMed 62. ↵ Pluska , L. , Jarosch , E. , Zauber , H. , Kniss , A. , Waltho , A. , Bagola , K. , von Delbrück , M. , Löhr , F. , Schulman , B.A. , Selbach , M. , et al. ( 2021 ). The UBA domain of conjugating enzyme Ubc1/Ube2K facilitates assembly of K48/K63-branched ubiquitin chains . EMBO J . 40 , e106094 . doi: 10.15252/embj.2020106094 . OpenUrl CrossRef PubMed 63. ↵ Lee , J.-G. , Youn , H.-S. , Kang , J.Y. , Park , S.-Y. , Kidera , A. , Yoo , Y.J. , and Eom , S.H . ( 2018 ). Crystal structure of the Ube2K/E2-25K and K48-linked di-ubiquitin complex provides structural insight into the mechanism of K48-specific ubiquitin chain synthesis . Biochem. Biophys. Res. Commun . 506 , 102 – 107 . doi: 10.1016/j.bbrc.2018.10.067 . OpenUrl CrossRef PubMed 64. ↵ Grice , G.L. , and Nathan , J.A . ( 2016 ). The recognition of ubiquitinated proteins by the proteasome . Cell Molecular Life Sciences 73 , 3497 – 3506 . doi: 10.1007/s00018-016-2255-5 . OpenUrl CrossRef PubMed 65. ↵ Xu , Z. , Kohli , E. , Devlin , K.I. , Bold , M. , Nix , J.C. , and Misra , S . ( 2008 ). Interactions between the quality control ubiquitin ligase CHIP and ubiquitin conjugating enzymes . BMC Struct. Biol . 8 , 26 – 26 . 25. doi: 10.1186/1472-6807-8-26 . OpenUrl CrossRef PubMed 66. ↵ Wang , X. , Chen , C.-F. , Baker , P.R. , Chen , P.-l. , Kaiser , P. , and Huang , L. ( 2007 ). Mass spectrometric characterization of the affinity-purified human 26S proteasome complex . Biochemistry 46 , 3553 – 3565 . OpenUrl CrossRef PubMed Web of Science 67. ↵ Unverdorben , P. , Beck , F. , Śledź , P. , Schweitzer , A. , Pfeifer , G. , Plitzko , J.M. , Baumeister , W. , and Förster , F. ( 2014 ). Deep classification of a large cryo-EM dataset defines the conformational landscape of the 26S proteasome . Proc Natl Acad Sci U S A 111 , 5544 – 5549 . doi: 10.1073/pnas.1403409111 . OpenUrl Abstract / FREE Full Text 68. ↵ Tong , Y. , Zhu , W. , Chen , J. , Wen , T. , Xu , F. , and Pang , J . ( 2023 ). Discovery of Small-Molecule Degraders for Alpha-Synuclein Aggregates . J. Med. Chem . 66 , 7926 – 7942 . doi: 10.1021/acs.jmedchem.3c00274 . OpenUrl CrossRef PubMed 69. ↵ Zhu , W. , Zhang , W. , Chen , J. , Tong , Y. , Xu , F. , and Pang , J . ( 2024 ). Discovery of Effective Dual PROTAC Degraders for Neurodegenerative Disease-Associated Aggregates . J. Med. Chem . 67 , 3448 – 3466 . doi: 10.1021/acs.jmedchem.3c01719 . OpenUrl CrossRef PubMed 70. ↵ Inuzuka , H. , Liu , J. , Wei , W. , and Rezaeian , A.H . ( 2022 ). PROTACs technology for treatment of Alzheimer’s disease: Advances and perspectives . Acta Mater Med 1 , 24 – 41 . doi: 10.15212/amm-2021-0001 . OpenUrl CrossRef PubMed 71. ↵ Wang , W. , Zhou , Q. , Jiang , T. , Li , S. , Ye , J. , Zheng , J. , Wang , X. , Liu , Y. , Deng , M. , Ke , D. , et al. ( 2021 ). A novel small-molecule PROTAC selectively promotes tau clearance to improve cognitive functions in Alzheimer-like models . Theranostics 11 , 5279 – 5295 . doi: 10.7150/thno.55680 . OpenUrl CrossRef PubMed 72. ↵ Hatakeyama , S. , Matsumoto , M. , Kamura , T. , Murayama , M. , Chui , D.H. , Planel , E. , Takahashi , R. , Nakayama , K.I. , and Takashima , A . ( 2004 ). U-box protein carboxyl terminus of Hsc70-interacting protein (CHIP) mediates poly-ubiquitylation preferentially on four-repeat Tau and is involved in neurodegeneration of tauopathy . J. Neurochem . 91 , 299 – 307 . doi: 10.1111/j.1471-4159.2004.02713.x . OpenUrl CrossRef PubMed Web of Science 73. ↵ Nadel , C.M. , Thwin , A.C. , Callahan , M. , Lee , K. , Connelly , E. , Craik , C.S. , Southworth , D.R. , and Gestwicki , J.E . ( 2023 ). The E3 ubiquitin ligase, CHIP/STUB1, inhibits aggregation of phosphorylated proteoforms of microtubule-associated protein Tau (MAPT) . J. Mol. Biol . 435 , 168026 . doi: 10.1016/j.jmb.2023.168026 . OpenUrl CrossRef PubMed 74. ↵ Dickey , C.A. , Yue , M. , Lin , W.L. , Dickson , D.W. , Dunmore , J.H. , Lee , W.C. , Zehr , C. , West , G. , Cao , S. , Clark , A.M. , et al. ( 2006 ). Deletion of the ubiquitin ligase CHIP leads to the accumulation, but not the aggregation, of both endogenous phospho- and caspase-3-cleaved tau species . The Journal of neuroscience: the official journal of the Society for Neuroscience 26 , 6985 – 6996 . OpenUrl Abstract / FREE Full Text 75. ↵ Koopman , M.B. , and Rüdiger , S.G.D . ( 2020 ). Alzheimer cells on their way to derailment show selective changes in protein quality control network . Front. Mol. Biosci . 7 , 214 . doi: 10.3389/fmolb.2020.00214 . OpenUrl CrossRef PubMed 76. ↵ Cliffe , R. , Sang , J.C. , Kundel , F. , Finley , D. , Klenerman , D. , and Ye , Y . ( 2019 ). Filamentous aggregates are fragmented by the proteasome holoenzyme . Cell reports 26 , 2140 – 2149 . e2143. OpenUrl PubMed 77. ↵ Ghag , G. , Bhatt , N. , Cantu , D.V. , Guerrero-Munoz , M.J. , Ellsworth , A. , Sengupta , U. , and Kayed , R . ( 2018 ). Soluble tau aggregates, not large fibrils, are the toxic species that display seeding and cross-seeding behavior . Protein Sci . 27 , 1901 – 1909 . doi: 10.1002/pro.3499 . OpenUrl CrossRef PubMed 78. ↵ Seo , H. , Sonntag , K.C. , and Isacson , O . ( 2004 ). Generalized brain and skin proteasome inhibition in Huntington’s disease . Ann. Neurol . 56 , 319 – 328 . OpenUrl CrossRef PubMed Web of Science 79. ↵ Keller , J.N. , Hanni , K.B. , and Markesbery , W.R . ( 2000 ). Impaired Proteasome Function in Alzheimer’s Disease . J. Neurochem . 75 , 436 – 439 . doi: 10.1046/j.1471-4159.2000.0750436.x . OpenUrl CrossRef PubMed Web of Science 80. ↵ Tseng , B.P. , Green , K.N. , Chan , J.L. , Blurton-Jones , M. , and LaFerla , F.M . ( 2008 ). Aβ inhibits the proteasome and enhances amyloid and tau accumulation . Neurobiol. Aging 29 , 1607 – 1618 . OpenUrl CrossRef PubMed Web of Science 81. ↵ Keck , S. , Nitsch , R. , Grune , T. , and Ullrich , O . ( 2003 ). Proteasome inhibition by paired helical filament-tau in brains of patients with Alzheimer’s disease . J. Neurochem . 85 , 115 – 122 . doi: 10.1046/j.1471-4159.2003.01642.x . OpenUrl CrossRef PubMed Web of Science 82. ↵ Hagemans , D. , van Belzen , I.A.M. , Morán Luengo , T. , and Rüdiger , S.G.D. ( 2015 ). A script to highlight hydrophobicity and charge on protein surfaces . Front. Mol. Biosci . 2 , 56 . doi: 10.3389/fmolb.2015.00056 . OpenUrl CrossRef PubMed 83. Middleton , A.J. , and Day , C.L . ( 2015 ). The molecular basis of lysine 48 ubiquitin chain synthesis by Ube2K . Sci Rep 5 , 16793 . doi: 10.1038/srep16793 . OpenUrl CrossRef PubMed 84. Dodd , P.R. , and Read , R.J . (To be published) . Structures of Two Human Ubiquitin-Conjugating Enzymes from Twinned Crystals . 85. Bosanac , I. , Phu , L. , Pan , B. , Zilberleyb , I. , Maurer , B. , Dixit , V.M. , Hymowitz , S.G. , and Kirkpatrick , D.S . ( 2011 ). Modulation of K11-linkage formation by variable loop residues within UbcH5A . J. Mol. Biol . 408 , 420 – 431 . doi: 10.1016/j.jmb.2011.03.011 . OpenUrl CrossRef PubMed View the discussion thread. Back to top Previous Next Posted November 04, 2025. Download PDF Email Thank you for your interest in spreading the word about bioRxiv. NOTE: Your email address is requested solely to identify you as the sender of this article. Your Email * Your Name * Send To * Enter multiple addresses on separate lines or separate them with commas. You are going to email the following Fibrilpaint20 directs the ubiquitin–proteasome system to Tau amyloid fibrils Message Subject (Your Name) has forwarded a page to you from bioRxiv Message Body (Your Name) thought you would like to see this page from the bioRxiv website. Your Personal Message CAPTCHA This question is for testing whether or not you are a human visitor and to prevent automated spam submissions. Share Fibrilpaint20 directs the ubiquitin–proteasome system to Tau amyloid fibrils Françoise A. Dekker , Júlia Aragonès Pedrola , Emile van Weert , Anne den Breejen , Laura Peters , Adriana Poza-Rodriguez , Guy Mayer , Shalini Singh , Alfred C.O. Vertegaal , Assaf Friedler , Stefan G. D. Rüdiger bioRxiv 2024.08.27.609886; doi: https://doi.org/10.1101/2024.08.27.609886 Share This Article: Copy Citation Tools Fibrilpaint20 directs the ubiquitin–proteasome system to Tau amyloid fibrils Françoise A. Dekker , Júlia Aragonès Pedrola , Emile van Weert , Anne den Breejen , Laura Peters , Adriana Poza-Rodriguez , Guy Mayer , Shalini Singh , Alfred C.O. Vertegaal , Assaf Friedler , Stefan G. D. Rüdiger bioRxiv 2024.08.27.609886; doi: https://doi.org/10.1101/2024.08.27.609886 Citation Manager Formats BibTeX Bookends EasyBib EndNote (tagged) EndNote 8 (xml) Medlars Mendeley Papers RefWorks Tagged Ref Manager RIS Zotero Tweet Widget Facebook Like Google Plus One Subject Area Biochemistry Subject Areas All Articles Animal Behavior and Cognition (7644) Biochemistry (17726) Bioengineering (13916) Bioinformatics (42033) Biophysics (21486) Cancer Biology (18635) Cell Biology (25549) Clinical Trials (138) Developmental Biology (13397) Ecology (19940) Epidemiology (2067) Evolutionary Biology (24361) Genetics (15620) Genomics (22541) Immunology (17763) Microbiology (40468) Molecular Biology (17207) Neuroscience (88739) Paleontology (667) Pathology (2842) Pharmacology and Toxicology (4834) Physiology (7659) Plant Biology (15175) Scientific Communication and Education (2047) Synthetic Biology (4304) Systems Biology (9834) Zoology (2272)

Text is read by the "Ask this paper" AI Q&A widget below. Extraction quality varies by source — PMC NXML preserves structure cleanly, OA-HTML may include some navigation residue, and OA-PDF can have broken hyphenation. The publisher copy (via DOI) is the canonical version.

My notes (saved in your browser only)

Ask this paper AI returns verbatim quotes from the full text · source: preprint-html

Answers must be backed by verbatim quotes from this paper's full text. Hallucinated quotes are dropped automatically; if no verbatim passage answers the question, we say so. How this works

Citation neighborhood (no data yet)

We don't have any in-corpus citations linked to this paper yet. This is a recent paper (2024) — citers typically take a year or two to land, and the OpenAlex reference graph may still be filling in.

Source provenance

europepmc
last seen: 2026-05-20T01:45:00.602351+00:00
unpaywall
last seen: 2026-06-05T02:00:03.366016+00:00
License: CC-BY-NC-4.0