Multi-epitope peptide sequence in-silico construction from HGV genome

preprint OA: closed CC-BY-4.0
📄 Open PDF Full text JSON View at publisher
AI-generated summary by claude@2026-07, 2026-07-14

This in-silico study constructed a multi-epitope peptide sequence from the HGV genome that showed high stability and potential for use as a triple vaccine against HCV, HGV, and for HIV management.

One-sentence paraphrase of the abstract; not a substitute for reading it. No clinical advice. How this works

AI-generated deep summary by claude@2026-07, 2026-07-14 · read from full text

This preprint uses reverse vaccinology and in-silico reverse immunology to design a multi-epitope peptide sequence based on the hepatitis G virus polyprotein precursor from the NCBI NCBI virus database, with docking to tertiary TLR7 (PDB ID: 5GMF) and multiple prediction tools for antigenicity, allergenicity, structure, epitopes, and binding. The constructed peptide is 214 amino acids long and is predicted to be antigenic (VaxiJen score 0.462) and non-allergenic (AlgPred score −0.869), with physicochemical properties including stability (instability index 27.48) and a Ramachandran result of 89.2% residues in favored regions, plus docking with TLR7 producing a best conformation (global energy −4.41). The authors note limitations of reliance on web-tool predictions, less-than-expected favored-region percentage versus assumptions, and lack of advanced molecular dynamics simulations, and state experimental validation is needed. Relevance to endometriosis: The paper does not explicitly discuss endometriosis or adenomyosis; it was included in the corpus via a keyword match related to biomedical immunology/vaccine design workflows.

Read from the paper's body, not the abstract. Not a substitute for reading the paper. No clinical advice. How this works

Abstract

Abstract In this study I have approached through in-silico method or reverse vaccinology taking advantage of the genome sequence of hepatitis G virus. It serves its benefit of identifying antigens seen by both conventional as well as discovering any novel antigen. This peptide candidate can serve a triple purpose of hepatitis C vaccine, hepatitis G vaccine and HIV management addition. 89.2% of the residues were in the favoured region of Ramachandran plot. These points make it favourable for in-vitro trials and further refinement. Because of the high similarity of hepatitis C genome to hepatitis G genome, it is highly probable that this peptide sequence might act as both hepatitis C and hepatitis G vaccine. Patients with past or current HGV infection have higher CD4+ lymphocyte counts and better AIDS-free survival rates. This peptide sequence might cause a breakthrough in the treatment of HIV without exposing them to develop hepatitis.
Full text 36,598 characters · extracted from preprint-html · click to expand
Multi-epitope peptide sequence in-silico construction from HGV genome | Research Square window.SnipcartSettings = { analytics: { enabled: false } }; (function() { var accessVector = localStorage.getItem('access_vector') || ''; window.dataLayer = window.dataLayer || []; if (accessVector) { window.dataLayer.push({ user: { profile: { profileInfo: { snid: accessVector } } } }); } })(); (function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0],j=d.createElement(s),dl=l!='dataLayer'?'&l='+l:'';j.async=true;j.src='https://www.googletagmanager.com/gtm.js?id='+i+dl;f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-K279D39R'); Browse Preprints In Review Journals COVID-19 Preprints AJE Video Bytes Research Tools Research Promotion AJE Professional Editing AJE Rubriq About Preprint Platform In Review Editorial Policies Our Team Advisory Board Help Center Sign In Submit a Preprint Cite Share Download PDF Research Article Multi-epitope peptide sequence in-silico construction from HGV genome Kumar Sharp This is a preprint; it has not been peer reviewed by a journal. https://doi.org/ 10.21203/rs.3.rs-53866/v1 This work is licensed under a CC BY 4.0 License Status: Posted Version 1 posted You are reading this latest preprint version Abstract In this study I have approached through in-silico method or reverse vaccinology taking advantage of the genome sequence of hepatitis G virus. It serves its benefit of identifying antigens seen by both conventional as well as discovering any novel antigen. This peptide candidate can serve a triple purpose of hepatitis C vaccine, hepatitis G vaccine and HIV management addition. 89.2% of the residues were in the favoured region of Ramachandran plot. These points make it favourable for in-vitro trials and further refinement. Because of the high similarity of hepatitis C genome to hepatitis G genome, it is highly probable that this peptide sequence might act as both hepatitis C and hepatitis G vaccine. Patients with past or current HGV infection have higher CD4+ lymphocyte counts and better AIDS-free survival rates. This peptide sequence might cause a breakthrough in the treatment of HIV without exposing them to develop hepatitis. Biotechnology and Bioengineering Bioinformatics Hepatitis G vaccine hepatitis C HIV peptide reverse vaccinology Figures Figure 1 Figure 2 Figure 3 Figure 4 Figure 5 Figure 6 Figure 7 Introduction In this study I have approached through in-silico method or reverse vaccinology taking advantage of the genome sequence of hepatitis G virus. It serves its benefit of identifying antigens seen by both conventional as well as discovering any novel antigen [1]. With technological advancement in the field of immunology these studies have become easier and more accurate [2]. This peptide candidate can serve a triple purpose of hepatitis C vaccine, hepatitis G vaccine and HIV management addition. Methodology The procedure used in this study is entirely based on two previous studies [3][4]. It will not be repeated here but is summarised below in figure 1 after obtaining necessary permission from its authors. The modifications done in this study is as follows: The genome sequence of hepatitis G virus was taken from NCBI virus database [5] (accession number:NC001710) Polyprotein precursor protein of this genome is used in this study. Docking of final peptide sequence was done with tertiary structure of toll-like receptor 7 obtained from Protein Data Bank [6] (PDB ID:5GMF). Result The final multi-epitope sequence formed after performing step 1 and 2 of methodology comprised of 214 amino acids: GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKEAAAKAVEAGVT WYAAYLLDFVFVLLAAYVTDAVAAIQAAYDVALETELYGPGPGWPLYQAGLAVRP GKSGPGPGAASYLMGLGVGGNAQGPGPGPLYQAGLAVRPGKSAGPGPGAVFFSGL APLRMHPDGPGPGASYLMGLGVGGNAQTGPGPGVFFSGLAPLRMHPDV The above sequence distribution is as follows: GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRK EAAAK (The above sequence is beta-defensin adjuvant sequence with EAAAK linker) AVEAGVTWY AAY LLDFVFVLL AAY VTDAVAAIQ AAY DVALETELY GPGPG (Polyprotein precursor CTL epitopes linked to each other by AAY linker with highest immunogenicity and at the end with GPGPG linker to HTL epitopes) WPLYQAGLAVRPGKS GPGPG AASYLMGLGVGGNAQ GPGPG PLYQAGLAVRPGKSA GPGPG AVFFSGLAPLRMHPD GPGPG ASYLMGLGVGGNAQT GPGPG VFFSGLAPLRMHPDV (Polyprotein precursor HTL epitope with GPGPG linker) The antigenicity prediction as in step 3 by Vaxijen server predicted it to be a probable antigen with score 0.462. The allergenicity prediction as in step 3 by Algpred server predicted it to be a non-allergen with score of -0.86908598 (positive predictive value is 0% and negative predictive value is 0%). Physio-chemical properties as estimated by step 4 using ProtParam server gave the following results: Molecular weight:21806.21 Daltons Theoretical pI=9.28 Estimated half-life in E. coli: >10 hours (in vivo) Instability index: 27.48(stable) Aliphatic index: 80.79 Grand average of hydropathicity (GRAVY): 0.096 The secondary structure of the final multi-epitope sequence was computed using PHYRE 2 server: 40% comprised of alpha-helix, 3% of beta-strand, 13% of transmembrane helix and 22% was disordered (Figure 2). The tertiary structure obtained from PHYRE2 server was subjected to refinement by Galaxy Refine tool which generated 5 models as follows (Table 1): Model GDT-HA RMSD MolProbity Clash Score Poor rotamers Rama favoured Initial 1.0000 0.000 4.192 141.9 10.2 73.1 Model 1 0.9276 0.473 2.239 12.1 0.7 85.8 Model 2 0.9241 0.487 2.281 11.8 1.4 88.2 Model 3 0.9241 0.483 2.092 8.9 0.0 87.3 Model 4 0.9287 0.461 2.167 12.1 0.0 89.2 Model 5 0.9077 0.499 2.231 13.1 0.7 87.7 Table 1: Galaxy Refine structure models Model 4 was chosen as the best tertiary structure of the sequence for further analysis. It was visualized using UCSF Chimera software [7] (Figure 3). Ramachandran plot analysis by RAMPAGE server (Figure 4) gave the following result: Number of residues in favoured region (~98.0% expected): 189 (89.2%); Number of residues in allowed region (~2.0% expected): 15 (7.1%); Number of residues in outlier region: 8 (3.8%) The predicted B-cell linear epitopes were calculated using Ellipro suite (Figure 5 and 6). Toll-like receptor 7 was docked with the final model by PatchDock server and top 10 results were refined using FireDock server. Solution number 2 was the most favourable binding conformation with global energy at -4.41 and 0.00 repulsive Vander Waal forces. The docked model was visualized using UCSF Chimera (Figure 7). Discussion The protein sequence is predicted to be antigenic as well as non-allergic, hence proving its advantage of not producing any harmful hypersensitivity reaction in the body. It is basic in nature and has low molecular weight hence suitable for any route of administration except oral. It’s half-life in E. coli is >10 hours, hence can easily be cultured and extracted. It is thermally stable as indicated by instability index. It has various B-cell epitope stimulating site and molecular docking with toll like receptor TLR-7 shows that it binds easily it without any repulsive Van der Waal forces. Toll-like receptor 7 which induces immune response against ss-RNA organisms will elicit an immune response against this sequence considering it be an active virus and thus fulfilling its purpose as a vaccine. 89.2% of the residues were in the favoured region of Ramachandran plot. These points make it favourable for in-vitro trials and further refinement. All these studies were on web-tool prediction servers designed for such type of studies. Because of the high similarity of hepatitis C genome to hepatitis G genome, it is highly probable that this peptide sequence might act as both hepatitis C and hepatitis G vaccine [8]. Patients with past or current HGV infection have higher CD4+ lymphocyte counts and better AIDS-free survival rates [9][10][11]. This peptide sequence might cause a breakthrough in the treatment of HIV without exposing them to develop hepatitis. However, since they work on growing databases, these cannot give a complete surety for success in future stages. Along with the advantage of the study, there are some limitations. 22% of the predicted secondary structure is disordered. Instead of 98% proteins being in the favourable region of Ramachandran plot only 89.2% of them is present. Advanced molecular dynamic simulations were not performed like RMSD (root mean square deviation). These disadvantages need to be overcome with better resources but these early results do serve as a guiding path to build future work upon it. Conclusion This study has highlighted a potential candidate fulfilling its purpose as hepatitis C vaccine, hepatitis G vaccine and HIV management addition. In-depth studies and refinement might serve to be successful since it has very good results at such an early stage. It is needed to be validated experimentally. Declarations Conflict of interest: The author declares no conflict of interest. Source of funding: Nil. Ethical consideration Not required. References Rappuoli R. Reverse vaccinology. Current opinion in microbiology. 2000 Oct 1;3(5):445-50. Ali A, Khan A, Kaushik AC, Wang Y, Ali SS, Junaid M, Saleem S, Cho WC, Mao X, Wei DQ. Immunoinformatic and systems biology approaches to predict and validate peptide vaccines against Epstein–Barr virus (EBV). Scientific reports. 2019 Jan 24;9(1):1-2. Khan S, Khan A, Rehman AU, Ahmad I, Ullah S, Khan AA, Ali SS, Afridi SG, Wei DQ. Immunoinformatics and structural vaccinology driven prediction of multi-epitope vaccine against Mayaro virus and validation through in-silico expression. Infection, Genetics and Evolution. 2019 Sep 1; 73:390-400. Sharp K, Dange S. Application of In-Silico Reverse Vaccinology for Designing Multi-Epitope Vaccine Against Coronavirus (preprint available on ChemRxiv) https://doi.org/10.26434/chemrxiv.12345653 Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Sayers EW. GenBank. Nucleic acids research. 2011 Jan;39(Database issue): Bank PD. Protein data bank. Nature New Biol. 1971; 233:223. Pettersen EF, Goddard TD, Huang CC, Couch GS, Greenblatt DM, Meng EC, Ferrin TE. UCSF Chimera—a visualization system for exploratory research and analysis. Journal of computational chemistry. 2004 Oct;25(13):1605-12. Kim JP, Fry KE. Molecular characterization of the hepatitis G virus. J Viral Hepat 1997; 4: 77-79 Toyoda H, Fukuda Y, Hayakawa T, Takamatsu J, Saito H. Effect of GB virus C/hepatitis G virus coinfection on the course of HIV infection in haemophilia patients in Japan. J Acquir Immune Defic Syndr Hum Retrovirol. 1998; 17:209-13. Sabin CA, Devereux H, Kinson Z, Griffioen A, Brown D, Dusheiko G, et al. Effect of coinfection with hepatitis G virus on HIV disease progression in hemophilic men. J Acquir Immune Defic Syndr Hum Retrovirol. 1998;19: 546-8. Lefre` re JJ, Roudot-Thoraval F, Morand-Joubert L, Petit JC, Lerable J, Thauvin M, et al. Carriage of GB virus C/hepatitis G virus RNA is associated with a slower immunologic, virologic, and clinical progression of human immunodeficiency virus disease in coinfected persons. J Infect Dis. 1999;179: 783-9. Cite Share Download PDF Status: Posted Version 1 posted You are reading this latest preprint version Research Square lets you share your work early, gain feedback from the community, and start making changes to your manuscript prior to peer review in a journal. As a division of Research Square Company, we’re committed to making research communication faster, fairer, and more useful. We do this by developing innovative software and high quality services for the global research community. Our growing team is made up of researchers and industry professionals working together to solve the most critical problems facing scientific publishing. Also discoverable on Platform About Our Team In Review Editorial Policies Advisory Board Help Center Resources Author Services Accessibility API Access RSS feed Manage Cookie Preferences © Research Square 2026 | ISSN 2693-5015 (online) Privacy Policy Terms of Service Do Not Sell My Personal Information {"props":{"pageProps":{"initialData":{"identity":"rs-53866","acceptedTermsAndConditions":true,"allowDirectSubmit":true,"archivedVersions":[],"articleType":"Research Article","associatedPublications":[],"authors":[{"id":1211808,"identity":"def8f2ae-4678-478c-b282-217ed10783ae","order_by":0,"name":"Kumar Sharp","email":"data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAZAAAAAyAQMAAABI0h/eAAAABlBMVEX///8AAABVwtN+AAAACXBIWXMAAA7EAAAOxAGVKw4bAAAA5UlEQVRIiWNgGAWjYBACCQYeMMXDxt58AMSQIVaLjRwfz7EEsF5itaQZy0n4GIBYhLVI9p89+Llyx+HENgmez69u1FjwMLAfProBnxZpibxkybNngFqke7dZ5xwDOownLe0GPi1yEjwGko1tQC0yZ7cZ57ABtUjwmOHXwn/G+CdYi0TOM+Ocf0RokWbIMQPakmbMJpHD/Di3jQgtkjNyzCwbz9jIsfEcM2PO7QNGECG/SJw/Y3yzcYcEj3x78+PPOd/q5PjZDx/DqwUMGBvAFJsEmCSoHEkL8weiVI+CUTAKRsGIAwAXHET/i1EL4wAAAABJRU5ErkJggg==","orcid":"https://orcid.org/0000-0002-5034-8326","institution":"Government Medical College and Hospital, Jalgaon ","correspondingAuthor":true,"prefix":"","firstName":"Kumar","middleName":"","lastName":"Sharp","suffix":""}],"badges":[],"createdAt":"2020-08-05 05:56:31","currentVersionCode":1,"declarations":{"humanSubjects":false,"vertebrateSubjects":false,"conflictsOfInterestStatement":true,"humanSubjectEthicalGuidelines":false,"humanSubjectConsent":false,"humanSubjectClinicalTrial":false,"humanSubjectCaseReport":false,"vertebrateSubjectEthicalGuidelines":false,"coiExplicitlySet":false},"doi":"10.21203/rs.3.rs-53866/v1","doiUrl":"https://doi.org/10.21203/rs.3.rs-53866/v1","draftVersion":[],"editorialEvents":[],"editorialNote":"","failedWorkflow":false,"files":[{"id":1823062,"identity":"9c188cc0-ba2c-4448-8f26-1eb8289cda6b","added_by":"auto","created_at":"2020-08-06 18:17:39","extension":"png","order_by":1,"title":"Figure 1","display":"","copyAsset":false,"role":"figure","size":414268,"visible":true,"origin":"","legend":"Methodology summary from a similar previous study. Reproduced with permission from the authors.","description":"","filename":"F1.png","url":"https://assets-eu.researchsquare.com/files/rs-53866/v1/F1.png"},{"id":1823063,"identity":"a8e52a52-aae7-424a-b684-fa62cb4d9855","added_by":"auto","created_at":"2020-08-06 18:17:39","extension":"png","order_by":2,"title":"Figure 2","display":"","copyAsset":false,"role":"figure","size":1024544,"visible":true,"origin":"","legend":"Secondary structure of vaccine sequence.","description":"","filename":"F2.png","url":"https://assets-eu.researchsquare.com/files/rs-53866/v1/F2.png"},{"id":1823064,"identity":"2907a6f1-ed01-44fa-9bbc-516a405c8f6c","added_by":"auto","created_at":"2020-08-06 18:17:39","extension":"png","order_by":3,"title":"Figure 3","display":"","copyAsset":false,"role":"figure","size":286256,"visible":true,"origin":"","legend":"Model 4 tertiary structure.","description":"","filename":"F3.png","url":"https://assets-eu.researchsquare.com/files/rs-53866/v1/F3.png"},{"id":1823065,"identity":"ec169537-4bcd-47d1-a7db-3c84e984b95b","added_by":"auto","created_at":"2020-08-06 18:17:39","extension":"png","order_by":4,"title":"Figure 4","display":"","copyAsset":false,"role":"figure","size":244168,"visible":true,"origin":"","legend":"Ramachandran Plot analysis of the final vaccine tertiary structure.","description":"","filename":"F4.png","url":"https://assets-eu.researchsquare.com/files/rs-53866/v1/F4.png"},{"id":1823066,"identity":"d3ae575b-af9e-4489-b7f1-76893f656a9a","added_by":"auto","created_at":"2020-08-06 18:17:40","extension":"png","order_by":5,"title":"Figure 5","display":"","copyAsset":false,"role":"figure","size":246688,"visible":true,"origin":"","legend":"B-cell linear epitopes predicted by Ellipro suite","description":"","filename":"F5.png","url":"https://assets-eu.researchsquare.com/files/rs-53866/v1/F5.png"},{"id":1823067,"identity":"5175c174-e1d0-4bec-a74a-6b1ef66e6778","added_by":"auto","created_at":"2020-08-06 18:17:40","extension":"png","order_by":6,"title":"Figure 6","display":"","copyAsset":false,"role":"figure","size":705353,"visible":true,"origin":"","legend":"Epitope score chart from Ellipro suite","description":"","filename":"F6.png","url":"https://assets-eu.researchsquare.com/files/rs-53866/v1/F6.png"},{"id":1823068,"identity":"0a71bb0d-6d68-4d1b-928f-d5fa3c77b85d","added_by":"auto","created_at":"2020-08-06 18:17:40","extension":"png","order_by":7,"title":"Figure 7","display":"","copyAsset":false,"role":"figure","size":510871,"visible":true,"origin":"","legend":"Peptide model(red) docked with Toll-like receptor 7(blue).","description":"","filename":"F7.png","url":"https://assets-eu.researchsquare.com/files/rs-53866/v1/F7.png"},{"id":13569186,"identity":"c7c5a9ad-d1f8-43ce-88ad-9a9c9553e8b1","added_by":"auto","created_at":"2021-09-17 03:39:07","extension":"pdf","order_by":0,"title":"","display":"","copyAsset":false,"role":"manuscript-pdf","size":3116849,"visible":true,"origin":"","legend":"","description":"","filename":"manuscript.pdf","url":"https://assets-eu.researchsquare.com/files/rs-53866/v1/80c50040-c0cc-443f-93e3-a400aefab83a.pdf"}],"financialInterests":"","formattedTitle":"\u003cp\u003eMulti-epitope peptide sequence in-silico construction from HGV genome\u003c/p\u003e","fulltext":[{"header":"Introduction","content":"\u003cp\u003eIn this study I have approached through in-silico method or reverse vaccinology taking advantage of the genome sequence of hepatitis G virus. It serves its benefit of identifying antigens seen by both conventional as well as discovering any novel antigen [1]. With technological advancement in the field of immunology these studies have become easier and more accurate [2]. This peptide candidate can serve a triple purpose of hepatitis C vaccine, hepatitis G vaccine and HIV management addition.\u003c/p\u003e"},{"header":"Methodology","content":"\u003cp\u003eThe procedure used in this study is entirely based on two previous studies [3][4]. It will not be repeated here but is summarised below in figure 1 after obtaining necessary permission from its authors.\u003c/p\u003e\n\u003cp\u003eThe modifications done in this study is as follows:\u003c/p\u003e\n\u003cp\u003eThe genome sequence of hepatitis G virus was taken from NCBI virus database [5] (accession number:NC001710) Polyprotein precursor protein of this genome is used in this study. Docking of final peptide sequence was done with tertiary structure of toll-like receptor 7 obtained from Protein Data Bank [6] (PDB ID:5GMF).\u003c/p\u003e"},{"header":"Result","content":"\u003cp\u003eThe final multi-epitope sequence formed after performing step 1 and 2 of methodology comprised of 214 amino acids:\u003c/p\u003e\n\u003cp\u003eGIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKEAAAKAVEAGVT WYAAYLLDFVFVLLAAYVTDAVAAIQAAYDVALETELYGPGPGWPLYQAGLAVRP GKSGPGPGAASYLMGLGVGGNAQGPGPGPLYQAGLAVRPGKSAGPGPGAVFFSGL APLRMHPDGPGPGASYLMGLGVGGNAQTGPGPGVFFSGLAPLRMHPDV\u003c/p\u003e\n\u003cp\u003eThe above sequence distribution is as follows:\u003c/p\u003e\n\u003cp\u003eGIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRK EAAAK\u003c/p\u003e\n\u003cp\u003e(The above sequence is beta-defensin adjuvant sequence with EAAAK linker)\u003c/p\u003e\n\u003cp\u003eAVEAGVTWY AAY LLDFVFVLL AAY VTDAVAAIQ AAY DVALETELY GPGPG\u003c/p\u003e\n\u003cp\u003e(Polyprotein precursor CTL epitopes linked to each other by AAY linker with highest immunogenicity and at the end with GPGPG linker to HTL epitopes)\u003c/p\u003e\n\u003ctable\u003e\n\u003ctbody\u003e\n\u003ctr\u003e\n\u003ctd width=\"195\"\u003e\n\u003cp\u003eWPLYQAGLAVRPGKS\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"107\"\u003e\n\u003cp\u003eGPGPG\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"223\"\u003e\n\u003cp\u003eAASYLMGLGVGGNAQ\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"83\"\u003e\n\u003cp\u003eGPGPG\u003c/p\u003e\n\u003c/td\u003e\n\u003c/tr\u003e\n\u003ctr\u003e\n\u003ctd width=\"195\"\u003e\n\u003cp\u003ePLYQAGLAVRPGKSA\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"107\"\u003e\n\u003cp\u003eGPGPG\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"223\"\u003e\n\u003cp\u003eAVFFSGLAPLRMHPD\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"83\"\u003e\n\u003cp\u003eGPGPG\u003c/p\u003e\n\u003c/td\u003e\n\u003c/tr\u003e\n\u003c/tbody\u003e\n\u003c/table\u003e\n\u003cp\u003eASYLMGLGVGGNAQT GPGPG VFFSGLAPLRMHPDV\u003c/p\u003e\n\u003cp\u003e(Polyprotein precursor HTL epitope with GPGPG linker)\u003c/p\u003e\n\u003cp\u003eThe antigenicity prediction as in step 3 by Vaxijen server predicted it to be a probable antigen with score 0.462. The allergenicity prediction as in step 3 by Algpred server predicted it to be a non-allergen with score of -0.86908598 (positive predictive value is 0% and negative predictive value is 0%).\u003c/p\u003e\n\u003cp\u003ePhysio-chemical properties as estimated by step 4 using ProtParam server gave the following results:\u003c/p\u003e\n\u003cp\u003eMolecular weight:21806.21 Daltons\u003c/p\u003e\n\u003cp\u003eTheoretical pI=9.28\u003c/p\u003e\n\u003cp\u003eEstimated half-life in E. coli: \u0026gt;10 hours (in vivo)\u003c/p\u003e\n\u003cp\u003eInstability index: 27.48(stable)\u003c/p\u003e\n\u003cp\u003eAliphatic index: 80.79\u003c/p\u003e\n\u003cp\u003eGrand average of hydropathicity (GRAVY): 0.096\u003c/p\u003e\n\u003cp\u003eThe secondary structure of the final multi-epitope sequence was computed using PHYRE 2 server: 40% comprised of alpha-helix, 3% of beta-strand, 13% of transmembrane helix and 22% was disordered (Figure 2).\u003c/p\u003e\n\u003cp\u003eThe tertiary structure obtained from PHYRE2 server was subjected to refinement by Galaxy Refine tool which generated 5 models as follows (Table 1):\u003c/p\u003e\n\u003ctable border=\"1\"\u003e\n\u003ctbody\u003e\n\u003ctr\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e\u003cstrong\u003eModel\u003c/strong\u003e\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e\u003cstrong\u003eGDT-HA\u003c/strong\u003e\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e\u003cstrong\u003eRMSD\u003c/strong\u003e\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"93\"\u003e\n\u003cp\u003e\u003cstrong\u003eMolProbity\u003c/strong\u003e\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e\u003cstrong\u003eClash Score\u003c/strong\u003e\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e\u003cstrong\u003ePoor rotamers\u003c/strong\u003e\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e\u003cstrong\u003eRama favoured\u003c/strong\u003e\u003c/p\u003e\n\u003c/td\u003e\n\u003c/tr\u003e\n\u003ctr\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e\u003cstrong\u003eInitial\u003c/strong\u003e\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e1.0000\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e0.000\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"93\"\u003e\n\u003cp\u003e4.192\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e141.9\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e10.2\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e73.1\u003c/p\u003e\n\u003c/td\u003e\n\u003c/tr\u003e\n\u003ctr\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e\u003cstrong\u003eModel 1\u003c/strong\u003e\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e0.9276\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e0.473\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"93\"\u003e\n\u003cp\u003e2.239\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e12.1\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e0.7\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e85.8\u003c/p\u003e\n\u003c/td\u003e\n\u003c/tr\u003e\n\u003ctr\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e\u003cstrong\u003eModel 2\u003c/strong\u003e\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e0.9241\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e0.487\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"93\"\u003e\n\u003cp\u003e2.281\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e11.8\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e1.4\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e88.2\u003c/p\u003e\n\u003c/td\u003e\n\u003c/tr\u003e\n\u003ctr\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e\u003cstrong\u003eModel 3\u003c/strong\u003e\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e0.9241\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e0.483\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"93\"\u003e\n\u003cp\u003e2.092\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e8.9\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e0.0\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e87.3\u003c/p\u003e\n\u003c/td\u003e\n\u003c/tr\u003e\n\u003ctr\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e\u003cstrong\u003eModel 4\u003c/strong\u003e\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e0.9287\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e0.461\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"93\"\u003e\n\u003cp\u003e2.167\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e12.1\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e0.0\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e89.2\u003c/p\u003e\n\u003c/td\u003e\n\u003c/tr\u003e\n\u003ctr\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e\u003cstrong\u003eModel 5\u003c/strong\u003e\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e0.9077\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e0.499\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"93\"\u003e\n\u003cp\u003e2.231\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"87\"\u003e\n\u003cp\u003e13.1\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e0.7\u003c/p\u003e\n\u003c/td\u003e\n\u003ctd width=\"88\"\u003e\n\u003cp\u003e87.7\u003c/p\u003e\n\u003c/td\u003e\n\u003c/tr\u003e\n\u003c/tbody\u003e\n\u003c/table\u003e\n\u003cp\u003eTable 1: Galaxy Refine structure models\u003c/p\u003e\n\u003cp\u003eModel 4 was chosen as the best tertiary structure of the sequence for further analysis. It was visualized using UCSF Chimera software [7] (Figure 3).\u003c/p\u003e\n\u003cp\u003eRamachandran plot analysis by RAMPAGE server (Figure 4) gave the following result: Number of residues in favoured region (~98.0% expected): 189 (89.2%); Number of residues in allowed region (~2.0% expected): 15 (7.1%); Number of residues in outlier region: 8 (3.8%)\u003c/p\u003e\n\u003cp\u003eThe predicted B-cell linear epitopes were calculated using Ellipro suite (Figure 5 and 6).\u003c/p\u003e\n\u003cp\u003eToll-like receptor 7 was docked with the final model by PatchDock server and top 10 results were refined using FireDock server. Solution number 2 was the most favourable binding conformation with global energy at -4.41 and 0.00 repulsive Vander Waal forces. The docked model was visualized using UCSF Chimera (Figure 7).\u003c/p\u003e\n\u003cp\u003e\u0026nbsp;\u003c/p\u003e"},{"header":"Discussion","content":"\u003cp\u003eThe protein sequence is predicted to be antigenic as well as non-allergic, hence proving its advantage of not producing any harmful hypersensitivity reaction in the body. It is basic in nature and has low molecular weight hence suitable for any route of administration except oral. It\u0026rsquo;s half-life in E. coli is \u0026gt;10 hours, hence can easily be cultured and extracted. It is thermally stable as indicated by instability index. It has various B-cell epitope stimulating site and molecular docking with toll like receptor TLR-7 shows that it binds easily it without any repulsive Van der Waal forces. Toll-like receptor 7 which induces immune response against ss-RNA organisms will elicit an immune response against this sequence considering it be an active virus and thus fulfilling its purpose as a vaccine. 89.2% of the residues were in the favoured region of Ramachandran plot. These points make it favourable for in-vitro trials and further refinement. All these studies were on web-tool prediction servers designed for such type of studies. Because of the high similarity of hepatitis C genome to hepatitis G genome, it is highly probable that this peptide sequence might act as both hepatitis C and hepatitis G vaccine [8]. Patients with past or current HGV infection have higher CD4+ lymphocyte counts and better AIDS-free survival rates [9][10][11]. This peptide sequence might cause\u0026nbsp; a breakthrough in the treatment of HIV without exposing them to develop hepatitis. However, since they work on growing databases, these cannot give a complete surety for success in future stages. Along with the advantage of the study, there are some limitations. 22% of the predicted secondary structure is disordered. Instead of 98% proteins being in the favourable region of Ramachandran plot only 89.2% of them is present. Advanced molecular dynamic simulations were not performed like RMSD (root mean square deviation). These disadvantages need to be overcome with better resources but these early results do serve as a guiding path to build future work upon it.\u003c/p\u003e"},{"header":"Conclusion","content":"\u003cp\u003eThis study has highlighted a potential candidate fulfilling its purpose as hepatitis C vaccine, hepatitis G vaccine and HIV management addition. In-depth studies and refinement might serve to be successful since it has very good results at such an early stage. It is needed to be validated experimentally.\u003c/p\u003e"},{"header":"Declarations","content":"\u003ch3\u003eConflict of interest:\u003c/h3\u003e\n\u003cp\u003eThe author declares no conflict of interest.\u003c/p\u003e\n\u003ch3\u003eSource of funding:\u003c/h3\u003e\n\u003cp\u003eNil.\u003c/p\u003e\n\u003ch3\u003eEthical consideration\u003c/h3\u003e\n\u003cp\u003eNot required.\u003c/p\u003e"},{"header":"References","content":"\u003col\u003e\n\u003cli\u003eRappuoli R. Reverse vaccinology. Current opinion in microbiology. 2000 Oct 1;3(5):445-50.\u003c/li\u003e\n\u003cli\u003eAli A, Khan A, Kaushik AC, Wang Y, Ali SS, Junaid M, Saleem S, Cho WC, Mao X, Wei DQ. Immunoinformatic and systems biology approaches to predict and validate peptide vaccines against Epstein\u0026ndash;Barr virus (EBV). Scientific reports. 2019 Jan 24;9(1):1-2.\u003c/li\u003e\n\u003cli\u003eKhan S, Khan A, Rehman AU, Ahmad I, Ullah S, Khan AA, Ali SS, Afridi SG, Wei DQ. Immunoinformatics and structural vaccinology driven prediction of multi-epitope vaccine against Mayaro virus and validation through in-silico expression. Infection, Genetics and Evolution. 2019 Sep 1; 73:390-400.\u003c/li\u003e\n\u003cli\u003eSharp K, Dange S. Application of In-Silico Reverse Vaccinology for Designing Multi-Epitope Vaccine Against Coronavirus (preprint available on ChemRxiv) https://doi.org/10.26434/chemrxiv.12345653\u003c/li\u003e\n\u003cli\u003eBenson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Sayers EW. GenBank. Nucleic acids research. 2011 Jan;39(Database issue):\u003c/li\u003e\n\u003cli\u003eBank PD. Protein data bank. Nature New Biol. 1971; 233:223.\u003c/li\u003e\n\u003cli\u003ePettersen EF, Goddard TD, Huang CC, Couch GS, Greenblatt DM, Meng EC, Ferrin TE. UCSF Chimera\u0026mdash;a visualization system for exploratory research and analysis. Journal of computational chemistry. 2004 Oct;25(13):1605-12.\u003c/li\u003e\n\u003cli\u003eKim JP, Fry KE. Molecular characterization of the hepatitis G virus. J Viral Hepat 1997; 4: 77-79\u003c/li\u003e\n\u003cli\u003eToyoda H, Fukuda Y, Hayakawa T, Takamatsu J, Saito H. Effect of GB virus C/hepatitis G virus coinfection on the course of HIV infection in haemophilia patients in Japan. J Acquir Immune Defic Syndr Hum Retrovirol. 1998; 17:209-13.\u003c/li\u003e\n\u003cli\u003eSabin CA, Devereux H, Kinson Z, Griffioen A, Brown D, Dusheiko G, et al. Effect of coinfection with hepatitis G virus on HIV disease progression in hemophilic men. J Acquir Immune Defic Syndr Hum Retrovirol. 1998;19: 546-8.\u003c/li\u003e\n\u003cli\u003eLefre` re JJ, Roudot-Thoraval F, Morand-Joubert L, Petit JC, Lerable J, Thauvin M, et al. Carriage of GB virus C/hepatitis G virus RNA is associated with a slower immunologic, virologic, and clinical progression of human immunodeficiency virus disease in coinfected persons. J Infect Dis. 1999;179: 783-9.\u003c/li\u003e\n\u003c/ol\u003e"}],"fulltextSource":"","fullText":"","funders":[],"hasAdminPriorityOnWorkflow":false,"hasManuscriptDocX":true,"hasOptedInToPreprint":true,"hasPassedJournalQc":"","hasAnyPriority":true,"hideJournal":true,"highlight":"","institution":"","isAcceptedByJournal":false,"isAuthorSuppliedPdf":false,"isDeskRejected":"","isHiddenFromSearch":false,"isInQc":false,"isInWorkflow":false,"isPdf":false,"isPdfUpToDate":true,"isWithdrawnOrRetracted":false,"journal":{"display":true,"email":"[email protected]","identity":"researchsquare","isNatureJournal":false,"hasQc":true,"allowDirectSubmit":true,"externalIdentity":"","sideBox":"","snPcode":"","submissionUrl":"/submission","title":"Research Square","twitterHandle":"researchsquare","acdcEnabled":true,"dfaEnabled":false,"editorialSystem":"","reportingPortfolio":"","inReviewEnabled":false,"inReviewRevisionsEnabled":true},"keywords":"Hepatitis G, vaccine, hepatitis C, HIV, peptide, reverse vaccinology","lastPublishedDoi":"10.21203/rs.3.rs-53866/v1","lastPublishedDoiUrl":"https://doi.org/10.21203/rs.3.rs-53866/v1","license":{"name":"CC BY 4.0","url":"https://creativecommons.org/licenses/by/4.0/"},"manuscriptAbstract":"\u003cp\u003eIn this study I have approached through in-silico method or reverse vaccinology taking advantage of the genome sequence of hepatitis G virus. It serves its benefit of identifying antigens seen by both conventional as well as discovering any novel antigen. This peptide candidate can serve a triple purpose of hepatitis C vaccine, hepatitis G vaccine and HIV management addition. 89.2% of the residues were in the favoured region of Ramachandran plot. These points make it favourable for in-vitro trials and further refinement. Because of the high similarity of hepatitis C genome to hepatitis G genome, it is highly probable that this peptide sequence might act as both hepatitis C and hepatitis G vaccine. Patients with past or current HGV infection have higher CD4+ lymphocyte counts and better AIDS-free survival rates. This peptide sequence might cause a breakthrough in the treatment of HIV without exposing them to develop hepatitis.\u003c/p\u003e","manuscriptTitle":"Multi-epitope peptide sequence in-silico construction from HGV genome","msid":"","msnumber":"","nonDraftVersions":[{"code":1,"date":"2020-08-06 18:17:38","doi":"10.21203/rs.3.rs-53866/v1","editorialEvents":[{"type":"communityComments","content":0}],"status":"published","journal":{"display":true,"email":"[email protected]","identity":"researchsquare","isNatureJournal":false,"hasQc":true,"allowDirectSubmit":true,"externalIdentity":"","sideBox":"","snPcode":"","submissionUrl":"/submission","title":"Research Square","twitterHandle":"researchsquare","acdcEnabled":true,"dfaEnabled":false,"editorialSystem":"","reportingPortfolio":"","inReviewEnabled":false,"inReviewRevisionsEnabled":true}}],"origin":"","ownerIdentity":"cf367afb-3f47-46b2-b554-122f090d05f0","owner":[],"postedDate":"August 6th, 2020","published":true,"recentEditorialEvents":[],"rejectedJournal":[],"revision":"","amendment":"","status":"posted","subjectAreas":[{"id":243236,"name":"Biotechnology and Bioengineering"},{"id":243237,"name":"Bioinformatics"}],"tags":[],"updatedAt":"2020-08-06T18:17:38+00:00","versionOfRecord":[],"versionCreatedAt":"2020-08-06 18:17:38","video":"","vorDoi":"","vorDoiUrl":"","workflowStages":[]},"version":"v1","identity":"rs-53866","journalConfig":"researchsquare"},"__N_SSP":true},"page":"/article/[identity]/[[...version]]","query":{"redirect":"/article/rs-53866","identity":"rs-53866","version":["v1"]},"buildId":"_2-kVJe1T_tPrBINL-cwx","isFallback":false,"isExperimentalCompile":false,"dynamicIds":[84888],"gssp":true,"scriptLoader":[]}

Text is read by the "Ask this paper" AI Q&A widget below. Extraction quality varies by source — PMC NXML preserves structure cleanly, OA-HTML may include some navigation residue, and OA-PDF can have broken hyphenation. The publisher copy (via DOI) is the canonical version.

My notes (saved in your browser only)

Ask this paper AI returns verbatim quotes from the full text · source: preprint-html

Answers must be backed by verbatim quotes from this paper's full text. Hallucinated quotes are dropped automatically; if no verbatim passage answers the question, we say so. How this works

Citation neighborhood (no data yet)

We don't have any in-corpus citations linked to this paper yet. The paper's references may be in our DB but unresolved to ``paper_id`` (resolution happens at ingest when the cited DOI matches a row we already have). Run the cross-source citation reconcile pass to retry.

Source provenance

europepmc
last seen: 2026-05-19T01:45:01.086888+00:00
unpaywall
last seen: 2026-06-04T02:00:05.705006+00:00
License: CC-BY-4.0