Nuclear Factor I in neurons, glia and during the formation of Müller glia-derived progenitor cells in avian, porcine and primate retinas

preprint OA: closed
📄 Open PDF Full text JSON View at publisher
⚙ AI-generated deep summary by qwen3.7-flash, 2026-09-08 · read from full text ⓘ

This study characterizes the expression patterns of Nuclear Factor I (NFI) isoforms, specifically NFIA and NFIB, in the retinas of avian, porcine, and primate models using single-cell RNA sequencing and immunolabeling. The researchers found that NFI levels are low in early progenitors but up-regulate during Müller glia differentiation and remain high in mature resting glia and neurons. Although NFI expression decreases in activated Müller glia-derived progenitor cells following injury or treatment, these levels remain significantly higher than those observed in neurogenic retinal progenitor cells. The authors propose that this persistent NFI expression suppresses the full neurogenic potential of Müller glia-derived progenitor cells in chicks, pigs, and monkeys. The paper does not explicitly discuss endometriosis or adenomyosis; it was included in the corpus via a keyword match in the upstream search index.

Read from the paper's body, not the abstract. Not a substitute for reading the paper. No clinical advice. How this works

Abstract

The regenerative potential of Müller glia (MG) is extraordinary in fish, poor in chick and terrible in mammals. In the chick model, MG readily reprogram into proliferating Müller glia-derived progenitor cells (MGPCs), but neuronal differentiation is very limited. The factors that suppress the neurogenic potential of MGPCs in the chick are slowly being revealed. Isoforms of Nuclear Factor I (NFI) are cell-intrinsic factors that limit neurogenic potential; these factors are required for the formation of MG in the developing mouse retina (Clark et al., 2019) and deletion of these factors reprograms MG into neuron-like cells in mature mouse retina (Hoang et al., 2020). Accordingly, we sought to characterize the patterns of expression NFIs in the developing, mature and damaged chick retina. In addition, we characterized patterns of expression of NFIs in the retinas of large mammals, pigs and monkeys. Using a combination of single cell RNA-sequencing (scRNA-seq) and immunolabeling we probed for patterns of expression. In embryonic chick, levels of NFIs are very low in early E5 (embryonic day 5) retinal progenitor cells (RPCs), up-regulated in E8 RPCs, further up-regulated in differentiating MG at E12 and E15. NFIs are maintained in mature resting MG, microglia and neurons. Levels of NFIs are reduced in activated MG in retinas treated with NMDA and/or insulin+FGF2, and further down-regulated in proliferating MGPCs. However, levels of NFIs in MGPCs were significantly higher than those seen in RPCs. Immunolabeling for NFIA and NFIB closely matched patterns of expression revealed in different types of retinal neurons and glia, consistent with findings from scRNA-seq. In addition, we find expression of NFIA and NFIB through progenitors in the circumferential marginal zone at the far periphery of the retina. We find similar patterns of expression for NFIs in scRNA-seq databases for pig and monkey retinas. Patterns of expression of NFIA and NFIB were validated with immunofluorescence in pig and monkey retinas wherein these factors were predominantly detected in MG and a few types of inner retinal neurons. In summary, NFIA and NFIB are prominently expressed in developing chick retina and by mature neurons and glia in the retinas of chicks, pigs and monkeys. Although levels of NFIs are decreased in chick, in MGPCs these levels remain higher than those seen in neurogenic RPCs. We propose that the neurogenic potential of MGPCs in the chick retina is suppressed by NFIs.
Full text 84,831 characters · extracted from preprint-html · click to expand
Nuclear Factor I in neurons, glia and during the formation of Müller glia-derived progenitor cells in avian, porcine and primate retinas | bioRxiv /* */ /* */ <!-- <!-- /*! * yepnope1.5.4 * (c) WTFPL, GPLv2 */ (function(a,b,c){function d(a){return"[object Function]"==o.call(a)}function e(a){return"string"==typeof a}function f(){}function g(a){return!a||"loaded"==a||"complete"==a||"uninitialized"==a}function h(){var a=p.shift();q=1,a?a.t?m(function(){("c"==a.t?B.injectCss:B.injectJs)(a.s,0,a.a,a.x,a.e,1)},0):(a(),h()):q=0}function i(a,c,d,e,f,i,j){function k(b){if(!o&&g(l.readyState)&&(u.r=o=1,!q&&h(),l.onload=l.onreadystatechange=null,b)){"img"!=a&&m(function(){t.removeChild(l)},50);for(var d in y[c])y[c].hasOwnProperty(d)&&y[c][d].onload()}}var j=j||B.errorTimeout,l=b.createElement(a),o=0,r=0,u={t:d,s:c,e:f,a:i,x:j};1===y[c]&&(r=1,y[c]=[]),"object"==a?l.data=c:(l.src=c,l.type=a),l.width=l.height="0",l.onerror=l.onload=l.onreadystatechange=function(){k.call(this,r)},p.splice(e,0,u),"img"!=a&&(r||2===y[c]?(t.insertBefore(l,s?null:n),m(k,j)):y[c].push(l))}function j(a,b,c,d,f){return q=0,b=b||"j",e(a)?i("c"==b?v:u,a,b,this.i++,c,d,f):(p.splice(this.i++,0,a),1==p.length&&h()),this}function k(){var a=B;return a.loader={load:j,i:0},a}var l=b.documentElement,m=a.setTimeout,n=b.getElementsByTagName("script")[0],o={}.toString,p=[],q=0,r="MozAppearance"in l.style,s=r&&!!b.createRange().compareNode,t=s?l:n.parentNode,l=a.opera&&"[object Opera]"==o.call(a.opera),l=!!b.attachEvent&&!l,u=r?"object":l?"script":"img",v=l?"script":u,w=Array.isArray||function(a){return"[object Array]"==o.call(a)},x=[],y={},z={timeout:function(a,b){return b.length&&(a.timeout=b[0]),a}},A,B;B=function(a){function b(a){var a=a.split("!"),b=x.length,c=a.pop(),d=a.length,c={url:c,origUrl:c,prefixes:a},e,f,g;for(f=0;f<d;f++)g=a[f].split("="),(e=z[g.shift()])&&(c=e(c,g));for(f=0;f<b;f++)c=x[f](c);return c}function g(a,e,f,g,h){var i=b(a),j=i.autoCallback;i.url.split(".").pop().split("?").shift(),i.bypass||(e&&(e=d(e)?e:e[a]||e[g]||e[a.split("/").pop().split("?")[0]]),i.instead?i.instead(a,e,f,g,h):(y[i.url]?i.noexec=!0:y[i.url]=1,f.load(i.url,i.forceCSS||!i.forceJS&&"css"==i.url.split(".").pop().split("?").shift()?"c":c,i.noexec,i.attrs,i.timeout),(d(e)||d(j))&&f.load(function(){k(),e&&e(i.origUrl,h,g),j&&j(i.origUrl,h,g),y[i.url]=2})))}function h(a,b){function c(a,c){if(a){if(e(a))c||(j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}),g(a,j,b,0,h);else if(Object(a)===a)for(n in m=function(){var b=0,c;for(c in a)a.hasOwnProperty(c)&&b++;return b}(),a)a.hasOwnProperty(n)&&(!c&&!--m&&(d(j)?j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}:j[n]=function(a){return function(){var b=[].slice.call(arguments);a&&a.apply(this,b),l()}}(k[n])),g(a[n],j,b,n,h))}else!c&&l()}var h=!!a.test,i=a.load||a.both,j=a.callback||f,k=j,l=a.complete||f,m,n;c(h?a.yep:a.nope,!!i),i&&c(i)}var i,j,l=this.yepnope.loader;if(e(a))g(a,0,l,0);else if(w(a))for(i=0;i (function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0];var j=d.createElement(s);var dl=l!='dataLayer'?'&l='+l:'';j.src='//www.googletagmanager.com/gtm.js?id='+i+dl;j.type='text/javascript';j.async=true;f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-M677548'); Skip to main content Home About Submit ALERTS / RSS Search for this keyword Advanced Search New Results Nuclear Factor I in neurons, glia and during the formation of Müller glia-derived progenitor cells in avian, porcine and primate retinas View ORCID Profile Heithem M. El-Hodiri , View ORCID Profile Warren A. Campbell , Lisa E. Kelly , Evan C. Hawthorn , Maura Schwartz , Archana Jalligampala , View ORCID Profile Maureen A. McCall , View ORCID Profile Kathrin Meyer , View ORCID Profile Andy J. Fischer doi: https://doi.org/10.1101/2021.07.13.451621 Heithem M. El-Hodiri 1 Department of Neuroscience, College of Medicine, The Ohio State University , Columbus, OH Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Heithem M. El-Hodiri Warren A. Campbell 1 Department of Neuroscience, College of Medicine, The Ohio State University , Columbus, OH Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Warren A. Campbell Lisa E. Kelly 1 Department of Neuroscience, College of Medicine, The Ohio State University , Columbus, OH Find this author on Google Scholar Find this author on PubMed Search for this author on this site Evan C. Hawthorn 1 Department of Neuroscience, College of Medicine, The Ohio State University , Columbus, OH Find this author on Google Scholar Find this author on PubMed Search for this author on this site Maura Schwartz 2 Center for Gene Therapy, Nationwide Children’s Hospital , Columbus, OH Find this author on Google Scholar Find this author on PubMed Search for this author on this site Archana Jalligampala 3 Department of Ophthalmology and Visual Sciences, University of Louisville , Louisville, KY Find this author on Google Scholar Find this author on PubMed Search for this author on this site Maureen A. McCall 3 Department of Ophthalmology and Visual Sciences, University of Louisville , Louisville, KY Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Maureen A. McCall Kathrin Meyer 2 Center for Gene Therapy, Nationwide Children’s Hospital , Columbus, OH Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Kathrin Meyer Andy J. Fischer 1 Department of Neuroscience, College of Medicine, The Ohio State University , Columbus, OH Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Andy J. Fischer For correspondence: Andrew.Fischer{at}osumc.edu Abstract Full Text Info/History Metrics Data/Code Preview PDF Abstract The regenerative potential of Müller glia (MG) is extraordinary in fish, poor in chick and terrible in mammals. In the chick model, MG readily reprogram into proliferating Müller glia-derived progenitor cells (MGPCs), but neuronal differentiation is very limited. The factors that suppress the neurogenic potential of MGPCs in the chick are slowly being revealed. Isoforms of Nuclear Factor I (NFI) are cell-intrinsic factors that limit neurogenic potential; these factors are required for the formation of MG in the developing mouse retina ( Clark et al., 2019 ) and deletion of these factors reprograms MG into neuron-like cells in mature mouse retina ( Hoang et al., 2020 ). Accordingly, we sought to characterize the patterns of expression NFIs in the developing, mature and damaged chick retina. In addition, we characterized patterns of expression of NFIs in the retinas of large mammals, pigs and monkeys. Using a combination of single cell RNA-sequencing (scRNA-seq) and immunolabeling we probed for patterns of expression. In embryonic chick, levels of NFIs are very low in early E5 (embryonic day 5) retinal progenitor cells (RPCs), up-regulated in E8 RPCs, further up-regulated in differentiating MG at E12 and E15. NFIs are maintained in mature resting MG, microglia and neurons. Levels of NFIs are reduced in activated MG in retinas treated with NMDA and/or insulin+FGF2, and further down-regulated in proliferating MGPCs. However, levels of NFIs in MGPCs were significantly higher than those seen in RPCs. Immunolabeling for NFIA and NFIB closely matched patterns of expression revealed in different types of retinal neurons and glia, consistent with findings from scRNA-seq. In addition, we find expression of NFIA and NFIB through progenitors in the circumferential marginal zone at the far periphery of the retina. We find similar patterns of expression for NFIs in scRNA-seq databases for pig and monkey retinas. Patterns of expression of NFIA and NFIB were validated with immunofluorescence in pig and monkey retinas wherein these factors were predominantly detected in MG and a few types of inner retinal neurons. In summary, NFIA and NFIB are prominently expressed in developing chick retina and by mature neurons and glia in the retinas of chicks, pigs and monkeys. Although levels of NFIs are decreased in chick, in MGPCs these levels remain higher than those seen in neurogenic RPCs. We propose that the neurogenic potential of MGPCs in the chick retina is suppressed by NFIs. Introduction Müller glia (MG) are the primary glial cell of the retina that serves pleiotropic functions including neurotransmitter recycling, osmotic balance, structural support, potassium siphoning, and bicarbonate transport ( Reichenbach and Bringmann, 2013 ). Importantly, MG retain stem cell properties and are capable of replacing lost neurons. However, the regenerative potential of MG is variable among species. Zebrafish can regenerate all retinal neurons, while mice fail to form any MG-derived progenitor cells (MGPCs). MG in chick retinas have an intermediate potential with significant proliferation of MGPCs but limited neurogenesis into a few neuronal subtypes. The limited regenerative potential in chicks serves as an insightful in vivo model to investigate factors that influence retinal regeneration. The factors underlying the limited neurogenic capacity of MGPCs in the chick retina remain poorly understood. Nuclear Factor I (NFI) gene products are known to promote gliogenesis ( Deneen et al., 2006 ; Wilczynska et al., 2009 ). Studies in the developing nervous system have indicated that the loss-of-function mutations of NFI genes suppress glial differentiation ( Namihira et al., 2009 ; Piper et al., 2010 ; Kang et al., 2012 ). NFIs, including NFIA, NFIB, NFIC and NFIX, are known to play important roles in the development of glia in the central nervous system. Further, NFIs are required for the differentiation of MG in the developing rodent retina ( Clark et al., 2019 ) and the targeted knock-out of Nfia , Nfib and Nfix promotes the reprogramming of MG into neurons in adult damaged mouse retinas ( Hoang et al., 2020 ). A comparative genomic analysis has revealed that NFIs are key components of regulatory networks that maintain resting glial phenotype of mouse MG and these regulatory “hubs” are absent in zebrafish MG ( Hoang et al., 2020 ). In zebrafish, the pathways that drive the initial de-differentiation and reprogramming of MG include MAPK-ERK, Gsk3β-β catenin, and Jak-stat. Similarly, factors such as let-7, TGFβ, and insulinoma-associated 1a (Insm1a) drive progenitors out of the cell cycle to enable neurogenesis ( Goldman, 2014 ). Many of these important cell signaling pathways can be recapitulated in the chick retina to stimulate MGPC formation and enhance neurogenesis ( Todd and Fischer, 2015 ; Todd et al., 2016a ; Zelinka et al., 2016 ; Todd et al., 2017a , 2018 ). However, neurogenesis from MGPCs in the chick retina remains very limited suggesting that there may be cell intrinsic factors that suppress neurogenic potential. Cell signaling has been shown to influence from neurogenesis from MGPCs. In the chick, neuronal differentiation of the progeny of MGPCs can be enhanced by inhibiting Notch ( Hayes et al., 2007 ; Ghai et al., 2010 ), inhibiting glucocortioids ( Gallina et al., 2014 ), activation of retinoic acid ( Todd et al., 2018 ), and inhibition of Jak/Stat-signaling ( Todd et al., 2016a ). In the mouse retina, neuronal differentiation from Ascl1a-overexpressing MG can be enhanced by inhibiting Jak/Stat-signaling ( Jorstad et al., 2020 ) or ablating reactive microglia ( Todd et al., 2020 ). During neural development there are many factors that act to suppress neurogenesis and in favor of gliogenesis. For example, Notch-signaling and downstream transcription effector Hes1/Hes5 have been shown to promote glial specification and differentiation during later stages of retinal development ( Furukawa et al., 2000 ; Vetter and Moore, 2001 ; Bernardos et al., 2005 ). During late stages of development, TGFB suppresses the proliferation of progenitors and maturing MG in the rat retina ( Close et al., 2005 ). In addition, TGFB/Smad2/3-signaling suppresses the formation of MGPCs in chick and zebrafish retinas ( Lenkowski et al., 2013 ; Tappeiner et al., 2016 ; Todd et al., 2017a ; Lee et al., 2020 ) and act to coordinate activity between microglia and MG ( Ma et al., 2019 ). During mouse retinal development knock-out Nfia, Nfib and Nfix results in a loss of MG and a prolonged period of proliferation postnatally ( Clark et al., 2019 ). In the adult mouse retina, knock-out Nfia, Nfib and Nfix specifically in MG when combined with NMDA-induced damage and insulin+FGF2 results in the generation of cells that resemble inner retinal neurons ( Hoang et al., 2020 ). The purpose of this study was to characterize patterns of expression of NFIs in the chick retina during developing, in the mature retina, and following treatments that induce the formation of proliferating MGPCs. Further, we analyze patterns of expression of NFIs in the retinas of large mammals, pig and non-human primate. Methods and Materials Animals Avian Fertilized eggs were obtained from the Michigan State University, Department of Animal Science. Eggs were incubated at 37.5°C, with a 1hr cool- down to room temperature every 24hrs, rotated every 45 minutes, and maintained at a humidity of 45%. Embryos were harvested at different time points after incubation and staged according to guidelines established by Hamburger and Hamilton (Hamburger, 1951). The use of hatched chicks followed guidelines established by the National Institutes of Health and IACUC at the Ohio State University. P0 wildtype leghorn chicks ( Gallus gallus domesticus ) were obtained from Meyer Hatchery (Polk, Ohio). Post-hatch chicks were housed in stainless-steel brooders at 25°C with a diurnal cycle of 12 hours light, 12 hours dark (8:00 AM-8:00 PM) and provided water and Purina tm chick starter ad libitum . Porcine Wild-type pigs born from a heterozygous cross of a transgenic P23H miniature pig model were utilized for this study. The pigs were housed at the Kentucky Lions Eye Institute (Louisville, Kentucky) and managed according to the guidelines of the ARVO Statement for the Use of Animals in Ophthalmic and Vision Research. Pigs were fed a swine-specific feed (Harlan Teklad Miniswine Diet 8753; Envigo, Hackensack, NJ) twice daily and provided water ad libitum . Pigs were kept on a 14/10- hour light/dark cycle. Primate Cynomologous macaques ( Macaca fascicularis ) were housed at the Mannheimer Foundation (Homestead, Florida). Regular monitoring of overall health and body weight was performed to assess the welfare of the animals. All procedures were performed in accordance with the National Institutes of Health and approved by IACUC at the Mannheimer Foundation. Intraocular injections Chicks were anesthetized with 2.5% isoflurane mixed with oxygen from a non- rebreathing vaporizer. The intraocular injections were performed as previously described ( Fischer et al., 1998 ). With all injection paradigms, both pharmacological and vehicle treatments were administered to the right and left eye respectively. Compounds were injected in 20 μl sterile saline with 0.05 mg/ml bovine serum albumin added as a carrier. Compounds included: NMDA (500 nmol/dose; Sigma-Aldrich). Preparation of clodronate liposomes Clodronate liposomes were synthesized utilizing a modified protocol from previous descriptions ( Van Rooijen, 1989 ; van Rooijen, 1992 ; Zelinka et al., 2012 ). In short, approximately 8 mg of L-α-Phosphatidyl-DL-glycerol sodium salt (Sigma P8318) was dissolved in chloroform. 50 mg of cholesterol was dissolved in chloroform with the lipids in a sterile microcentrifuge tube. This tube was rotated under nitrogen gas to evaporate the chloroform and leave a thin lipid-film on the walls of the tube. 158 mg dichloro-methylene diphosphonate (clodronate; Sigma-Aldrich) dissolved in sterile PBS (pH 7.4) was added to the lipid/cholesterol film and vortexed for 5 minutes. To reduce size variability of lipid vesicles, the mixture was sonicated at 42 kHz for 6 minutes. Purification of liposomes was accomplished via centrifugation at 10,000 x G for 15 minutes, aspirated, and resuspended in 150 µl PBS. Each retinal injection used between 5 and 20 ul of clodronate-liposome solution. There was a variable yield of clodronate-liposomes during the purification resulting in some variability per dose. The dosage was adjusted such that >98% of the microglia are ablated by 2 days after administration with no off-target cell death or pigmented epithelial cells. Single Cell RNA sequencing of retinas Retinas were obtained from embryonic chicks, hatched chicks, adult pigs and adult macaque monkeys. Isolated chick and macaque retinas were dissociated in a 0.25% papain solution in Hank’s balanced salt solution (HBSS), pH = 7.4, for 20-40 minutes, and suspensions were frequently triturated. Pig retinas were dissociated similarly except that papain was diluted using Earle’s balanced salt solution (EBSS). The dissociated cells were passed through a sterile 70µm filter to remove large particulate debris. Dissociated cells were assessed for viability (Countess II; Invitrogen) and cell-density diluted to 700 cell/µl. Each single cell cDNA library was prepared for a target of 10,000 cells per sample. The cell suspension and Chromium Single Cell 3’ V2 or V3 reagents (10X Genomics) were loaded onto chips to capture individual cells with individual gel beads in emulsion (GEMs) using 10X Chromium Controller. cDNA and library amplification for an optimal signal was 12 and 10 cycles respectively. Sequencing was conducted on Illumina HiSeq4000 (Novogene) with 30 bp for Read 1 and 98 bp for Read 2. Fasta sequence files were de-multiplexed, aligned, and annotated using the appropriate ENSMBL database (GRCg6a for chicken, Sscrofa 11.1 for pig, Mmul_10 for macaque) and Cell Ranger software. Gene expression was counted using unique molecular identifier bar codes, and gene-cell matrices were constructed. Using Seurat toolkits, Uniform Manifold Approximation and Projection for Dimension Reduction (UMAP) plots were generated from aggregates of multiple scRNA-seq libraries ( Satija et al., 2015 ; Butler et al., 2018 ). Seurat V3 was used to construct violin/scatter plots. Significance of difference in violin/scatter plots was determined using a Wilcoxon Rank Sum test with Bonferroni correction. Monocle was used to construct unbiased pseudo-time trajectories and scatter plotters for MG and MGPCs across pseudotime ( Trapnell et al., 2012 ; Qiu et al., 2017a ; b). Genes that were used to identify different types of retinal cells included the following: (1) Müller glia: GLUL, VIM, SCL1A3, RLBP1 , (2) MGPCs: PCNA, CDK1, TOP2A, ASCL1 , (3) microglia: C1QA, C1QB, CCL4, CSF1R, TMEM22 , (4) ganglion cells: THY1, POU4F2, RBPMS2, NEFL, NEFM , (5) amacrine cells: GAD67, CALB2, TFAP2A , (6) horizontal cells: PROX1, CALB2, NTRK1 , (7) bipolar cells: VSX1, OTX2, GRIK1, GABRA1 , and (7) cone photoreceptors: CALB1, GNAT2, OPN1LW , and (8) rod photoreceptors: RHO, NR2E3, ARR3. The MG have an over-abundant representation in the scRNA-seq databases. This likely resulted from fortuitous capture-bias and/or tolerance of the MG to the dissociation process. Fixation, sectioning and immunocytochemistry Retinal tissue samples were formaldehyde fixed, sectioned, and labeled via immunohistochemistry as described previously ( Fischer et al., 2008 ; Ghai et al., 2009 ). Samples processed for immunohistochemistry using antibodies against NFIB were fixed for a shorter period of time (10 minutes) and were pre-treated with 1% (w/v) saponin (Sigma-Aldrich) in phosphate-buffered saline (PBS; Fisher Scientific). Antibody dilutions and commercial sources for images used in this study are described in table 1 . View this table: View inline View popup Download powerpoint Table 1. List of antibodies, working dilution, clone/catalog number and source. The antisera used in this study included: ( 1 ) rabbit anti-NFIA was used at 1:300 (HPA006111; Atlas Antibodies). This antibody was raised to Recombinant Protein Epitope Signature Tag (PrEST) amino acid LKSVEDEMDSPGEEPFYTGQGRSPGS GSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRAS PHATPSTLHFPTSPIIQQ. Patterns of immunolabeling for NFIA precisely match patterns of expression of NFIA in scRNA-seq databases for retinal cells from chicks, pigs and monkeys (current study). (Antibody Registry ID: AB_185442). ( 2 ) rabbit anti- NFIB was used at 1:300 (LS-B13531; LSBio). This antibody was raised to amino acids 325 and 375 of human Nuclear Factor I/B. This antibody was validated by IHC on formalin fixed paraffin embedded human heart and lung and by western blot (manufacturer). Patterns of immunolabeling for NFIB precisely match patterns of expression of NFIB in scRNA-seq databases for retinal cells from chicks, pigs and monkeys (current study). (Antibody Registry ID: AB_185442). ( 3 ) goat anti-Sox2 was used at 1:1000 (Y-17; Santa Cruz Biotechnology). The antibody was raised to the recombinant C-terminus of human Sox2 and recognizes a single 34 kDa band in Western blot analysis of lysate from mouse embryonic stem cells (manufacturer). The Sox2 antibody is known to recognize amino acids 277-293 of human Sox2, as determined by preabsorption controls and mass spectrometry analysis of blocking peptide ( Poche et al., 2008 ). The Sox2 antibody produced a pattern of labeling in the nuclei of progenitors, Müller glia, astrocytes and cholinergic amacrine cells in the retina of different vertebrate species, consistent with previous reports ( Fischer et al., 2010b ). Patterns of immunolabeling for Sox2 precisely match patterns of expression of SOX2 in scRNA-seq databases for retinal cells from chicks, pigs and monkeys ( Supplemental Fig. 1 ). (Antibody Registry ID: AB_2286684). (4) rabbit anti-Sox9 was used at 1:2000 (AB5535; Millipore). This antibody was raised against human synthetic peptide amino acids VPSIPQTHSPQWEQPVYTQLTRP. Rabbit anti-Sox9 detects a 60-65 kDa band on Western blot analysis of mouse brain tissue (manufacturer’s information). In situ hybridization analysis of Sox9 mRNA in the embryonic retina produces an identical pattern to that seen using the Sox9 antibody ( Wright et al., 1995 ; Poche et al., 2008 ). (Antibody Registry ID: AB_2239761). (5) mouse anti-CD45 was used at 1:200 (HIS-C7; Prionics). This antibody was raised to chicken CD45 HIS-C7 monoclonal antibody (diluted 1/40; Cedi Diagnostics, Lelystad, The Netherlands; catalog 7500970, lot 03M020), obtained from the hybridoma cell line Ch/CD 45 HIS-C7, which is a specific marker for macrophages/microglial cells in the developing and mature chick central nervous system ( Cuadros et al., 2006 ; Brunet et al., 2007 ). (Antibody Registry ID: AB_2314144). (6) mouse anti-Nkx2.2 was used at 1:50 (74.5A5, Developmental Studies Hybridoma Bank; DSHB). This antibody was raised to Nkx2.2-GST fusion protein expressed in E. coli . Patterns of immunolabeling for Nkx2.2 have been well-established in in chick retina ( Fischer et al., 2010b ; a) and precisely match patterns of expression of NKX2-2 in scRNA-seq databases of chick retina ( Campbell et al., 2019 , 2021 ). (Antibody Registry ID: AB_531794). ( 7 ) mouse anti-neurofilament was used at 1:50 (RT97, DSHB). This antibody was raised to semi-purified neurofilaments from rat brain homogenate and recognizes phospho-epitopes on the tail domain of neurofilament at KSPXK or KSPXXXK motifs. Patterns of immunolabeling for neurofilament precisely match expression patterns observed with ISH ( Fischer et al., 2004 ) and scRNA-seq from chick retina ( Supplemental Fig. 1 ). (Antibody Registry ID: AB_528399). ( 8 ) mouse anti-AP2-alpha was used at 1:50 (AP2A; DSHB). This antibody was raised to full length recombinant human AP2-alpha. Patterns of immunolabeling for Nkx2.2 have been well- established in in chick retina ( Fischer et al., 2007 ; Campbell et al., 2021 ) and precisely match patterns of expression of TFAP2A in scRNA-seq databases of chick, pig and monkey retinas ( Supplemental Fig. 1 ). (Antibody Registry ID: AB_2619181). ( 9 ) mouse anti-Brn3a was used at 1:50 (MAB1585, clone 5A3.2 Millipore). This antibody was raised to amino acids 186-224 of Brn-3a fused to the T7 gene 10 protein ( Xiang et al., 1995 ). This antibody shows no reactivity to Brn-3a knock-out mice ( Xiang et al., 1996 ). Patterns of immunolabeling for Brn3a-alpha precisely match patterns of expression of POU4F2 in scRNA-seq databases of chick retina ( Gallina et al., 2014 ). (Antibody Registry ID: AB_94166). ( 10 ) mouse anti-Islet1 was used at 1:50 (40.2D6; DSHB). This antibody was raised to the C-terminus (amino acids 247–349) of rat Islet1. The 40.2D6 monoclonal antibody is known to recognize both Islet1 and Islet2 and has a well- established pattern of labeling in the chicken retina ( Fischer et al., 2008 ). Patterns of immunolabeling for Islet1 precisely match patterns of expression of ISL1 in scRNA-seq databases of chick retina ( Supplemental Fig. 1 ). (Antibody Registry ID: AB_528315). ( 11 ) goat anti-Otx2 was used at 1:1000 (AF1979; R&D Systems). This antibody was raised to recombinant human Otx2 (Met1-Leu289). Validation of this antibody has been performed via Western blot shows lysates of IMR-32 human neuroblastoma cell line (manufacturer). Patterns of immunolabeling for Otx2 precisely match patterns of expression of OTX2 in scRNA-seq databases of chick, pig and monkey ( Supplemental Fig. 1 ). (Antibody Registry ID: AB_2157172). ( 12 ) mouse anti-PCNA was used at 1:1000 (M0879; Dako Immunochemicals). This antibody was raised to a synthetic amino acid sequence (LVFEAPNQEK) from rat PCNA. Mouse anti-PCNA recognizes a single band at ∼36 kDa on western blot analysis of rat retinal extract ( Gordon et al., 2002 ). This antibody has been shown to recognize proliferating cells in the rodent retina ( Sigulinsky et al., 2008 ) chick retina ( Fischer and Reh, 2000 ; Ghai et al., 2008 ). Patterns of immunolabeling for PCNA precisely match patterns of expression of PCNA in scRNA- seq databases of chick retina ( Supplemental Fig. 1d ). (Antibody Registry ID: AB_2160651). ( 13 ) rabbit anti-p21-CIP1 was used at 1:200 (B9242 LSBio) This antibody was raised to a synthetic peptide (amino acids 111-160) from human p21- Cip1. Validation for IHC was done on formalin fixed paraffin embedded human uterus and endometrium tissue and peptide ELISA. Western blot with rabbit anti-p21-CIP1 recognizes a ∼26 kDa on western blot of COLO and K562 cells, and absent when blocked with the synthesized peptide. Patterns of immunolabeling for p21-CIP1 precisely match patterns of expression of CDKN1A in scRNA-seq databases of chick retina ( Supplemental Fig. 1 ). Download figure Open in new tab Supplemental Figure 1 scRNA-seq libraries were probed to validate patterns of expression of markers used for immunolabeling. Retinal libraries from chick, pig and monkey were probed. UMAP heatmap plots demonstrate patterns of expression for NKX2.2, OTX2, TFAP2A, CDKN1A, ISL1, SOX2, SOX9 and NEFL . Download figure Open in new tab Figure 1. Expression of NFIs in developing chick retinas. scRNA-seq was used to identify patterns of expression of NFIs among embryonic retinal cells at four stages of development, E5, E8, E12 and E15. UMAP-ordered clusters of cells were identified based on expression of cell-distinguishing markers ( a,b ). A heatmap of NFIA, NFIB, NFIC and NFIX illustrates expression profiles in different developing retinal cells ( c ). Each dot represents one cell and black dots indicate cells with 2 or more genes expressed. Violin plots illustrate the upregulation of NFIA , NFIB and NFIX in maturing MG ( d ). The number on each violin indicates the percentage of expressing cells. Significant difference (*p<0.01, **p<0.0001, ***p<<0.0001) in levels of expression was determined by using a Wilcox rank sum with Bonferoni correction. ( e ) Antibodies to NFIA were applied to vertical sections of central and peripheral regions of retinas from embryos at E5, E6, E8, E10, E12, E14 and E16. The calibration bar in e represents 50 µm. RPC – retinal progenitor cell, MG – Müller glia, iMG – immature Müller glia, mMG - mature Müller glia, ONL – outer nuclear layer, INL – inner nuclear layer, IPL – inner plexiform layer, GCL – ganglion cell layer. Observed labeling was not due to off-target labeling of secondary antibodies or tissue autofluorescence because sections incubated exclusively with secondary antibodies were devoid of fluorescence. Secondary antibodies utilized include donkey- anti-goat-Alexa488/568, goat-anti-rabbit-Alexa488/568/647, goat-anti-mouse- Alexa488/568/647, goat-anti-rat-Alexa488 (Life Technologies) diluted to 1:1000 in PBS and 0.1% Triton X-100. Photography, measurements, cell counts and statistics Microscopy images of retinal sections were captured with the Leica DM5000B microscope with epifluorescence and the Leica DC500 digital camera. High resolution confocal images were obtained with a Leica SP8 available in the Department of Neuroscience Imaging Facility at The Ohio State University. Representative images were modified to enhance brightness and contrast using Adobe Photoshop. The retinal region selected for investigation was standardized between treatment and control groups to reduce variability and improve reproducibility. Results NFIs in embryonic retina We re-probed scRNA-seq databases that have previously been used to compare MG and MGPCs across fish, chick and mouse model systems ( Hoang et al., 2020 ) and characterize expression patterns of genes related to NFkB-signaling ( Palazzo et al., 2020 ), midkine-signaling ( Campbell et al., 2021 ) and matrix metalloproteases ( Campbell et al., 2019 ). scRNA-seq libraries were established for retinas from chick embryos at E5, E8, E12, and E15. The aggregate library contained 22,698 cells after excluding doublets, and cells with low UMI and <400 genes. UMAP plots of embryonic retinal cells formed clustered of cells that correlated with developmental stage and cell type ( Fig. 1a,b ). Cell types were identified based on expression of well-established markers. Specifically, retinal progenitor cells from E5 and E8 retinas were identified by expression of ASCL1 , C DK1 , and TOP2A , and maturing MG were identified by expression of GLUL , RLBP1 and SLC1A3 ( Supplemental Fig. 2a,b ). Download figure Open in new tab Supplemental Figure 2 scRNA-seq libraries were generated for embryonic retinal cells at four stages of development, E5, E8, E12 and E15. UMAP-ordered clusters of cells were identified based on expression of cell-distinguishing markers, including genes characteristic of progenitors ( ASCL1, CDK1, TOP2A ) and maturing MG ( GLUL, RLBP1, SLC13A ) (a,b).(c) scRNA -libraries from post-hatch chick retinas were generated and UMAP-ordering of cells revealed distinct clusters of cells. Clusters of cells were identified using different cell-distinguishing genes including TFAP2A (amacrine cells), GRIK1, OTX2 (bipolar cells), GNAT2 (cone photoreceptors), RHO (rod bipolar cells), THY1 (retinal ganglion cells), OLIG2 (oligodendrocytes), PTPRZ1 (NIRG cells), GLUL (resting MG), and VIM (activated MG and MGPCs). scRNA-seq was used to identify patterns of expression of NFIs in MG and MGPCs at different time points after NMDA-damage and/or treatment with FGF + insulin. Nine different libraries were aggregated for a total of more than 55,000 MG and MGPCs (d). The Dot plot illustrates the average level of expression and percentage of expressing cells resting glial genes ( VIM, GLUL, RLBP1 ), genes characteristic of activated glial ( MAML2, WNT6, CTSK ), and proliferating MGPCs ( CDK1, TOP2A, PCNA ) (d). Download figure Open in new tab Figure 2. Patterns of expression of NFIA, NFIB, NFIC and NFIX in normal and NMDA-damaged chick retinas. scRNA-seq was used to identify patterns of expression of NFI’s among retinal cells with the data presented in UMAP ( a - c ) or violin plots ( d ). scRNA-seq libraries were aggregated for retinal cells from control eyes and eyes 24hr, 48hr, and 72hr after NMDA-treatment ( a ). UMAP-ordered cells formed distinct clusters of neuronal cells, resting MG, early activated MG, activated MG and MGPCs ( a,b ). Resting MG were identified based on elevated expression of SLC1A3, RLBP1, VIM and GLUL ( b ). Activated MG down-regulated SLC1A3, RLBP1 and GLUL , and MGPCs up- regulated proliferation markers including SPC25, PCNA, TOP2A and CDK1 ( b ). UMAP heatmaps of NFIA, NFIB, NFIC and NFIX demonstrate patterns of expression across retinal cell types. Violin plots illustrate the percentage of expressing cells, levels of gene expression and significant changes (***p<10exp-20) in levels (log TPM) were determined by using a Wilcox rank sum with Bonferoni correction. NFIA, NFIB, NFIC and NFIX were not expressed a significant levels in retinal progenitor cells at E5 ( Fig. 1c,d ). Expression of NFIC and NFIX were low across all cell types during retinal development ( Fig. 1c,d ). By comparison, NFIA and NFIB were expressed by relatively few E8 progenitors, and at increasing levels and numbers of immature MG at E8 and maturing MG at E12 and E15 ( Fig. 1c,d ). In addition, NFIA and NFIB were detected in a few differentiating ganglion, amacrine, bipolar and photoreceptor cells at later stages (E12 and E15) of development ( Fig. 1c ). To verify findings from scRNA-seq we applied antibodies to NFIA to retinal sections. Consistent with scRNA-seq data, NFIA-immunolabeling was absent from E5 retinas, but appeared at E6 in putative RPCs in the middle of prospective INL and differentiating neurons in the prospective IPL and GCL ( Fig. 1e ). At E8, NFIA-immunolabeling was present in the nuclei in putative RPCs, differentiating amacrine cells in the proximal INL, and differentiating ganglion cells ( Fig. 1e ). This pattern of labeling was similar at E10, with elevated levels seen in central retinal, similar levels in mid-peripheral retina, and very low levels in far peripheral retina ( Fig. 1e ). At E12 and E14, NFIA-immunofluorescence was present in the nuclei of scattered cells in the GCL and NFL, many presumptive amacrine cells in the proximal half of the INL, many presumptive differentiating MG in the middle of the INL, and scattered cells in the distal INL that likely were differentiating bipolar cells ( Fig. 1e ). By E16, patterns of immunolabeling for NFIA resembled that seen in post-hatch retina, with the exception of an absence of labeling in the ONL ( Fig. 1e ). According to scRNA-seq data, NFIB was detected in relatively few bipolar cells, rod photoreceptors and MG ( Figs. 1c,d ). Thus, we did not apply NFIB-antibodies to sections of embryonic retinas. Likewise, NFIC and NFIX were detected in very few embryonic retinal cells, and we thus did not probe for immunoreactivity. NFI’s in mature and damaged retinas We next analyzed patterns of expression of NFIs in post-hatch chick retinas, wherein the cell types are mature and functional. We analyzed aggregate scRNA-seq libraries of cells from control and NMDA-damaged retinas at various time points (24, 48 and 72 hrs) after treatment ( Fig. 2a ). UMAP plots revealed clusters of cells that were identified based on well-established patterns of expression ( Fig. 2a and Supplemental Fig. 2c ). Resting MG formed a discrete cluster of cells and expressed high levels of GLUL, RLBP1 and SLC1A3 ( Fig. 2b ). After damage, MG down-regulate markers of mature glia as they transition into reactive glial cells and into progenitor-like cells that up-regulate SPC25, PCNA, TOP2A and CDK1 ( Fig. 2b ). Levels of NFIA, NFIB, NFIC and NFIX were relatively high in resting MG ( Fig. 2c,d ). Following NMDA-induced damage, the levels of all NFIs were reduced in MG and MGPCs at 24hrs, 48hrs, and 72hrs after treatment ( Fig. 2c,d ). The expression of NFIA and NFIB was prevalent in oligodendrocytes and Non-astrocytic Inner Retinal Glia (NIRGs) ( Fig. 2c,d ). NIRG cells are a distinct type of glial cell that has been described in the retinas of birds ( Fischer et al., 2010a ; Rompani and Cepko, 2010 ) and some types of reptiles ( Todd et al., 2016b ). NFIC and NFIX were expressed by relatively few oligodendrocytes and NIRG cells ( Fig. 2d ). In addition, we detected relatively high levels of NFIA and NFIB in some types of bipolar cells ( Fig. 2c,d ). Immunolabeling for NFIA and NFIB To validate patterns of expression for NFIA and NFIB we performed immunofluorescence labeling in post-hatch chick retina. Immunofluorescence for NFIA was observed in different types of retinal neurons and glia. NFIA was detected in many AP2α-positive amacrine cells ( Fig. 3a ) and a few Brn3a-positive ganglion cells ( Fig. 3b ). Further, NFIA was detected in bipolar cells in the distal INL that were negative for Islet1, but positive for Otx2 ( Fig. 3c,d ). All Sox2-positive MG were co-labeled for NFIA, whereas cholinergic amacrine cells known to express Sox2 and Islet1 ( Stanke et al., 2008 ), were negative for NFIA ( Fig. 3e ). In addition, many Nkx2.2-positive NIRG cells in the IPL were co-labeled for NFIA ( Fig. 3f ). Download figure Open in new tab Figure 3. Immunofluorescence for NFIA in different types of cells in chick retina. Retinas were obtained from eyes that were injected with saline ( a - e ) or NMDA ( f ) and harvested 48 hrs after treatment. Vertical sections of the retina were labeled with antibodies to NFIA (green) and AP2α ( a ), Brn3a ( b ), Islet1 ( c ), Otx2 ( d ), Sox2 ( e ) or Nkx2.2 ( f ; red). Arrows indicate the nuclei of MG, small double arrows indicate the nuclei of NIRG cells, arrow heads indicate the nuclei of microglia, hollow arrow heads indicate nuclei of amacrine cells, small double-arrow heads indicate nuclei of bipolar cells, and double arrows indicate nuclei of ganglion cells. Areas indicated by blue boxes are enlarged 2-fold in the panels to the right. The calibration bar (50 µm) applies to all panels. Abbreviations: ONL – outer nuclear layer, INL – inner nuclear layer, IPL – inner plexiform layer, GCL – ganglion cell layer. Immunolabeling for NFIB revealed patterns of expression that closely matched those for scRNA-seq. NFIB-immunoreactivity was detected in; (i) a subset of amacrine cells that were Ap2α-positive, (ii) bipolar cells that were Otx2-positive and Islet1- negative), and (iii) all MG that were Sox2-positive ( Fig. 4a,b ). To determine whether NFIB-immunoreactivity was present in microglia and NIRG cells, we labeled NMDA- damaged retinas. All CD45+ microglia and Nkx2.2+ NIRG cells in the inner retina were labeled for NFIB at 24hrs after NMDA-treatment ( Fig. 4b ) Download figure Open in new tab Figure 4. Immunofluorescence for NFIB in different types of cells in chick retina. Retinas were obtained for eyes injected with saline ( a ) or NMDA ( b ) at 48hrs after treatment. Vertical sections of the retina were labeled with antibodies to NFIB (green) and AP2α ( a ), Islet1 ( a ), Otx2 ( a ), Sox2 ( b ), CD45 ( b ) or Nkx2.2 ( b ; red). Arrows indicate the nuclei of MG, small double arrows indicate the nuclei of NIRG cells, arrow heads indicate the nuclei of microglia, and hollow arrow heads indicate nuclei of amacrine cells. Panels to the right are enlarged 2-fold from the panels to the left. The calibration bar (50 µm) applies to all panels to the left. Abbreviations: ONL – outer nuclear layer, INL – inner nuclear layer, IPL – inner plexiform layer, GCL – ganglion cell layer. To further discriminate NFIA and NFIB in different types of bipolar cells we re- embedded scRNA-seq data for bipolar cells from control retinas. Unsupervised UMAP- ordering of cells revealed 11 distinct clusters of bipolar cells, based on patterns of expression for genes such as CALB2, ISL1, ARR3, SPON1, ALCAM, BHBHE23, PROX1 and GRIK1 ( Fig. 5a-d ). Consistent with recent findings from embryonic chick retinas ( Yamagata et al., 2021 ) all clusters of bipolar cells were positive for VSX1, VSX2 and OTX2 , and a binary segregation of types based on expression of ISL1 or GRIK1 (ON vs OFF bipolar cells). Clusters of cells that expressed NFIA overlapped with those that expressed NFIB , with the exception of cluster 8. NFIA and NFIB were predominantly expressed in clusters 4, 5, 6 and 11, which overlapped with expression of GRIK1 (Glutamate Ionotropic Receptor Kainate Type Subunit 1; Fig. 5c-f , suggesting that these cells were OFF-center bipolars. By comparison Yamagata and colleagues ( Yamagata et al., 2021 ) described 22 distinct types of bipolar cells in E16 chick retinas. Collectively, the findings from immunolabeling studies correlated very closely with the patterns of expression reveal by scRNA-seq. Immuolabeling for NFIA and NFIB in NMDA-damaged retinas failed to reveal significant differences in immunofluorescence in the nuclei of MG (not shown). Download figure Open in new tab Figure 5. Expression levels of NFIA and NFIB in different types of bipolar cells. Bipolar cells were isolated from aggregate scRNA-seq libraries from saline-treated retinas and re-embedded in UMAP plots. UMAP ordering of bipolar cells revealed 11 distinct clusters of cells ( a ). All bipolar cell clusters contained cells that expressed OTX2, VSX1 and VSX2 ( b ). ON- and OFF-center bipolar cells were distinctly clustered based on expression of ISL1 or GRIK1 ( c ). The dot plot in d illustrates the average expression level (heatmap) and percent expression (dot diameter) for bipolar ell markers that distinguished the different clusters of cells. The expression of NFIA and NFIB is illustrated UMAP heatmap and dot plots in distinct clusters of bipolar cells ( d - f ). NFI’s in eRPCs, MG, MGPCs and CMZ progenitors We next isolated MG, aggregated and normalized scRNA-seq data for cells from saline-, NMDA-, FGF2+insulin- and NMDA+FGF2+insulin-treated retinas to directly compare levels of NFIs. UMAP plots revealed distinct clustering of MG from control retinas and MG from 24hrs after NMDA-treatment, whereas MG from retinas at 48 and 72hrs after NMDA and from retinas treated with insulin and FGF2 formed a large cluster with distinct regions ( Fig. 6a-e ). UMAP plots revealed distinct patterns of expression of genes associated with resting MG, de-differentiating MG, activated MG and MGPCs ( Fig. 6c-e and Supplemental Fig. 2d ). Different zones, representing MGPCs in different phases of the cell cycle were comprised of cells from different times after NMDA- treatment and FGF2+insulin-treatment ( Fig. 6b,e ). Expression of NFIs was most widespread and elevated in MG in undamaged retinas compared to MG from retinas treated with NMDA and/or insulin and FGF2 ( Fig. 6f ). Levels of NFIs were down- regulated in MG by treatment with NMDA and/or insulin+FGF2, with the largest decreases in prevalence and levels seen with insulin+FGF2-treatment and in the MGPC3 cluster of cells ( Fig. 6f ). Download figure Open in new tab Figure 6. Comparison of NFI expression levels in Müller glia and MGPCs from different treatment conditions. scRNA-seq was used to identify patterns of expression of NFIs in MG and MGPCs at different time points after NMDA damage and/or FGF + insulin growth factor treatment. Nine different libraries were aggregated for a total of more than 55,000 MG and MGPCs ( a,c ). MGPCs were identified based on high-levels of expression of CDK1, TOP2A, PCNA and SPC25 ( c , e ), and were a mix of cells from 48hrs NMDA+FGF2+insulin, 48hrs NMDA, 72hrs NMDA and 3doses of insulin+FGF2 ( b ). Resting MG were identified based on expression of GLUL, RLBP1, SLC1A3 and VIM ( c,d ). Each dot represents one cell and black dots indicate cells with 2 or more genes expressed. The expression of NFIA, NFIB, NFIC and NFIX is illustrated violin plots with population percentages and statistical comparisons ( f ). Significance of difference (*p<0.01, **p<10 -10 , ***p<10 -20 ) in expression levels (log TPM) were determined by using a Wilcox rank sum with Bonferoni correction. Abbreviations: ONL – outer nuclear layer, INL – inner nuclear layer, IPL – inner plexiform layer, GCL – ganglion cell layer. To directly compare levels of NFIs in MGPCs and embryonic retinal progenitor cells (eRPCs) we isolated, aggregated and normalized scRNA-seq data for these cells. UMAP clustering of cells revealed distinct separation of proliferating embryonic RPCs and MGPCs ( Fig. 7a-c ). Although NFIA and NFIB were detected in E8 RPCs at high levels, the prevalence of expression among MGPCs was significantly higher ( Fig. 7d,f ). Levels of NFIC and NFIX were negligible in early and late RPCs, whereas levels were elevated and more wide-spread in MGPCs ( Fig. 5 (7e,f). Download figure Open in new tab Figure 7. Expression levels of NFI’s in embryonic RPCs, Müller glia, MGPCs and CMZ progenitors. scRNA-seq was used to compare patterns of expression of NFIs in embryonic retinal progenitor cells (eRPCs) and MGPCs from different time points after NMDA-damage and/or treatment with insulin+FGF2 ( a ). Seven different scRNA-seq libraries were aggregated for a total of 20,483 eRPCs and MGPCs ( a,b ). eRPCs and MGPCs expressed high levels of proliferation-associated genes including PCNA, SPC25, TOP2A and CDK1 ( c ). The expression of NFIA, NFIB, NFIC and NFIX is illustrated in UMAP heatmap plots and violin plots with population percentages and statistical comparisons ( d - f ). Significance of difference (**p<10exp-10, ***p<10exp-20) in expression levels (log TPM) were determined by using a Wilcox rank sum with Bonferoni correction. g – Sections of the far peripheral retina were label with antibodies to NFIA, NFIB, PCNA and p21cip1. The calibration bar represents 50 µm. Abbreviations: ONL – outer nuclear layer, INL – inner nuclear layer, IPL – inner plexiform layer, GCL – ganglion cell layer, CMZ – circumferential marginal zone, NPE – non-pigmented epithelium. We next examined whether retinal progenitors in the circumferential marginal zone (CMZ) expressed NFIA and NFIB. The eyes of hatched chicks are known to contain a zone of proliferating neuronal progenitors at the far peripheral edge of the retina ( Fischer and Reh, 2000 ; Fischer et al., 2002a ). These progenitors proliferate slowly, but can be stimulated by insulin and FG2 to proliferate at increased rates and generate inner retinal neurons and ganglion cells ( Fischer and Reh, 2000 ; Fischer et al., 2002a ). Our scRNA-seq databases did not include CMZ progenitors at the far peripheral edge of the retina. Thus, we immunolabeled sections of CMZ with antibodies to NFIA and NFIB. Immunofluorescence for NFIA and NFIB was detected in the nuclei of cells in the non-pigmented epithelium (NPE) of the ciliary body ( Fig. 7g ). In addition nuclear labeling for NFIA and NFIB was observed in cells through the CMZ and in numerous cells in the INL and ONL of the neural retina ( Fig. 7g ). The CMZ cells were identified by labeling for PCNA and p21 cip1 ( Fig. 7g ). NFIs in pig and monkey retinas We next sought to characterize the patterns of expression of NFIs in the retinas of large mammals. We analyzed retinal sections and scRNA-seq databases for adult pig and adult macaque monkeys. We aggregated scRNA-seq libraries from 4 normal adult pig retinas for a total of 15,236 cells ( Fig 8a ), after filtering out doublets, cells with low genes per cell and elevated mitochondrial RNA content. Different retinal cell types were ordered into distinct UMAP clusters, including 2 clusters of MG ( Fig. 8b ). The clusters of MG were segregated into resting and activated, with the activated cells expressing elevated levels of ATF3 , FOSB, EGR1, TCF7, FGFR1 and PAK3 ( Supplemental Fig. 3 ). We speculated that activated MG resulted from the process of tissue harvesting and tissue dissociation prior to capture with scRNA-seq reagents. We found that NFIA and NFIB were predominantly expressed in MG, but were also expressed by a few amacrine and bipolar cells ( Fig. 8c ). By comparison, NFIC and NFIX had relatively wide-spread expression in rod and cone photoreceptors, microglia, amacrine cells and bipolar cells ( Fig. 8c ). In addition, NFIC and NFIX were detected in resting and activated MG ( Fig. 8c ). Download figure Open in new tab Supplemental Figure 3. scRNA-seq was used to identify patterns of expression of genes associated with activated glia in adult pig retinas. Four different scRNA-seq libraries were aggregated for a total of 15,236 cells. UMAP clustered cells were identified based on cell-distinguishing markers (see figure 8 ). The expression of FGFR1, PAK3, ATF3, FOSB, EGR1 and TCF7 is illustrated in UMAP heatmap plots. Download figure Open in new tab Figure 8. NFI’s in the pig retina. scRNA-seq was used to identify patterns of expression of NFIs in adult pig retina. Four different scRNA-seq libraries were aggregated for a total of 15,236 cells ( a ). UMAP clustered cells were identified based on cell-distinguishing markers ( b ). The expression of NFIA, NFIB, NFIC and NFIX is illustrated in UMAP heatmap plots ( c ). Vertical sections of central and peripheral regions of the retina were labeled with antibodies to NFIA (green; d - f ), NFIB (green; g ), Sox2 (red; d and g ), Otx2 (red; e ), or AP2α (red; f ). Arrows indicate the nuclei of MG, small double arrows indicate the nuclei of an unidentified cell type in the NFL, hollow arrow heads indicate nuclei of amacrine cells, and small double-arrow heads indicate nuclei of bipolar cells. The calibration bar represents 50 µm. Abbreviations: ONL – outer nuclear layer, INL – inner nuclear layer, IPL – inner plexiform layer, GCL – ganglion cell layer. Consistent with scRNA-seq data from pig retinas, we detected immunofluorescence for NFIA in the nuclei of all Sox2-positive MG in the INL and in unidentified cells in the NFL ( Fig. 8d ). In addition, NFIA was detected in Otx2-positive bipolar cells, but only in peripheral regions of the retina ( Fig. 8e ). NFIA was detected in a few sparsely distributed cells in the amacrine cell layer of the INL and some of these cells were co-labeled for AP2α ( Fig. 8f ). By comparison, NFIB-immunofluorescence was detected in the nuclei of all Sox2+ MG in the INL and in sparsely distributed cells in the NFL ( Fig. 8g ). In addition, NFIB was detected in Sox9-positive nuclei that were scattered in the NFL ( Fig. 8g ). The identity of the NFIB/NFIA/Sox2-positive cells in the NFL remains uncertain. We next characterized the expression patterns of NFIs in the retina of the macaque monkey. For the monkey we aggregated scRNA-seq libraries from 2 normal adult retinas for a total of 14,287 cells after filtering out doublets, cells with low genes per cell and elevated mitochondrial RNA content. Different retinal cell types were ordered into distinct UMAP clusters based on patterns of expression of cell-identifying markers such as GNB3, PAX6, GRIK1 and RLBP1 ( Fig. 9a,b ). Similar to the patterns seen in the chick retina, NFIA and NFIB were detected in MG, rod bipolar cells, OFF bipolar cells and amacrine cells ( Fig. 9c,d ). NFIC and NFIX were detected in MG, rod bipolar cells, amacrine cells and OFF bipolar cells ( Fig. 9e,f ). The expression of NFIC was also prominent in rod photoreceptors ( Fig. 9e ). Download figure Open in new tab Figure 9. NFIs in the monkey retina. scRNA-seq was used to identify patterns of expression of NFIs in adult monkey retina. Two different scRNA-seq libraries were aggregated for a total of 14,319 cells ( a ). UMAP clustered cells were identified based on cell-distinguishing markers ( b ). The expression of NFIA, NFIB, NFIC and NFIX is illustrated in UMAP heatmap plots ( c-f ). Vertical sections of central and peripheral regions of the retina were labeled with antibodies to NFIA (green; g - i ), NFIB (green; j ), Sox2 (red; g and j ), Otx2 (red; h ), or AP2α (red; i ). Arrows indicate the nuclei of MG, small double arrows indicate the nuclei of an unidentified cell type in the NFL, hollow arrow heads indicate nuclei of amacrine cells, and small double-arrow heads indicate nuclei of bipolar cells. e. The calibration bar represents 50 µm. Abbreviations: ONL – outer nuclear layer, INL – inner nuclear layer, IPL – inner plexiform layer, GCL – ganglion cell layer. Consistent with scRNA-seq data from the monkey retina, NFIA-immunolabeling was detected in the nuclei of all Sox2-positive MG ( Fig. 9g ). In addition, NFIA was detected in a many cells in amacrine and bipolar cell layers of the INL ( Fig. 9g-i ). We observed sparsely distributed NFIA+ cells in the NFL that were co-labeled for Sox2( Fig. 9d ). Many of the NFIA+ cells in the distal INL were bipolar cells that were co-labeled for Otx2 ( Fig. 9h ), and many of the NFIA+ cells in the proximal INL were amacrine cells that were co-labeled for AP2α ( Fig. 9i ). NFIB-immunofluorescence was detected in the nuclei of all Sox2+ MG in the INL and sparsely distributed Sox2+ cells in the NFL ( Fig. 9j ). In addition, relatively low levels of NFIB were detected in presumptive amacrine and bipolar cells in the INL ( Fig. 9j ). The identity of the NFIA/NFIB/Sox2-positive cells in the NFL remains uncertain. Discussion This study demonstrates that NFI transcription factors are expressed by MG and by developing and differentiated neurons in the retinas of chicks, pigs and non-human primates. NFI expression is decreased in proliferating MGPCs in chick retinas. These observations are consistent with a role for NFI factors in promoting or maintaining differentiated neuronal or glial phenotype and limiting progenitor cell competence. NFIs are not likely to promote differentiated cells by forcing cells to exit the cell cycle, as these factors are widely expressed by proliferating MGPCs. This is in agreement with results from mouse retina, where overexpression of NFI gene products resulted in increases in numbers of MG and bipolar cells and deletion of NFI genes resulted in an increase in late progenitors at the expense of late-born retinal cell types ( Clark et al., 2019 ). NFIs may not suppress proliferation, but instead may suppress neurogenic potential or limit potential to late-born retinal cell types. NFIs are highly expressed by resting MG, but levels are reduced while remaining wide-spread in activated MG, prior to re-entering the cell cycle and by proliferating MGPCs. Similarly, proliferating CMZ retinal progenitors expressed NFIA and NFIB, and these progenitors are known to produce late-born retinal cell types such as amacrine cells and MG ( Fischer and Reh, 2000 ). We observed transient decreases in expression levels for all NFIs from resting MG to activated MG at 24hrs after NMDA-treatment. This observation is consistent with the hypothesis that de-differentiation occurs during activation of MG and transition to progenitor-like phenotype. We propose that transient down-regulation of NFIs is part of the process of MGPC formation. The largest decreases in numbers of MG that expressed NFIs was observed in retinas treated with insulin and FGF2. The combination of insulin and FGF2 is known to stimulate the formation of proliferating MGPCs in the absence of retinal damage ( Fischer et al., 2002b , 2009 ). FGF2 is potently neuroprotective while stimulating the formation of MGPCs when applied before NMDA- induced damage ( Fischer et al., 2014 ). Further, FGF2 is known to suppress the expression of glial genes during late stages of embryonic development ( Kruchkova et al., 2001 ). Similarly, our data from scRNA-seq indicate significant down-regulation of mRNA’s for mature glial markers, such as glutamine synthetase, GLAST1, and RLBP1 in MG treated with 2 doses of insulin and FGF2 without reprogramming into proliferating MGPCs ( Campbell et al., 2019 , 2021 ; Hoang et al., 2020 ; Palazzo et al., 2020 ). Collectively, the down-regulation of NFI’s in MG treated with insulin and FGF2 is consistent with the hypothesis that these growth factors drive the process of de- differentiation and this process involves reducing levels of NFIs. Comparison of expression patterns of NFIA and NFIB in the retinal neurons in chick, pig and monkey retinas Patterns of expression of NFI were similar across cell types in the retinas of chicks, pigs and monkeys. These patterns of expression were similar to those reported for cells in the mouse retina ( Keeley and Reese, 2018 ; Clark et al., 2019 ). For example, NFIA and NFIB were prominently expressed in MG in all species. However, there were some notable exceptions in differences in patterns of NFIs. NFIA was detected in cone photoreceptors in chick, but was not detected in photoreceptors in pig and monkey retinas. Microglia in the chick retina were immunoreactive for NFIA and NFIB, whereas NFIC and NFIX were detected in pig microglia and NFI’s were not detected in the microglia from the monkey retina. Expression of NFIA in bipolar and amacrine cells was prevalent in chick and monkey retinas, but not in pig retinas. The identity of the NFIA/NFIB/Sox2/Sox9-positive cells in the NFL remains uncertain. It is likely that these cells are astrocytes. In the retinas of mice, dogs and monkeys, astrocytes scattered in the NFL are known to be immunoreactive for Sox2, Sox9, S100β, Pax2 and GFAP ( Fischer et al., 2010b ; Stanke et al., 2010 ). NFIs in the chick CMZ Expression of NFIA and NFIB in the NPE of the ciliary body immediately anterior to the CMZ and within the neural retina suggests that the functions of NFIs are pleiotropic and context dependent. It is possible that the functions of NFIs in the NPE includes suppression of neurogenic potential. The NPE is derived from the neural tube but neurogenesis and proliferation is suppressed during development. However, treatment with different growth factors can stimulate proliferation and de novo neurogenesis from NPE cells in vivo in the chick model ( Fischer and Reh, 2003 ). In addition, NFIA and NFIB were detected in CMZ progenitors. These progenitors proliferate at relatively low levels and produce MG and inner retinal neurons, but can be stimulated by growth factor to proliferate at increased rates and generate retinal neurons ( Fischer and Reh, 2002 , 2003 ). It is possible that the expression of NFIs by CMZ progenitors acts to restrict competency to late-born cell types such as bipolar cells, amacrine cells and MG. NFIs in mature neurons and glia The functional roles for NFIs has been well-studied during the development of the CNS. However, the functional roles of NFIs remains uncertain in adult neuronal tissues. During development combined conditional knock-out of Nfia, Nfib and Nfix in radial glial cells prevents neuronal and glial differentiation, whereas deletion of individual NFI’s tends to result in delayed glial and neuronal differentiation (reviewed by Harris et al., 2015 ). The influence of NFIs on glial cells is likely coordinated with other transcription factors and cell signaling pathways that influence glial specification. In cortical stem cells, for example, Ezh2 a methyltransferase in the polycomb repressor complex 2 (PRC2) and Sox9 are repressed by NFIB and NFIX ( Heng et al., 2014 ). Ezh2 activity is required for the normal formation of MG in the retina ( Iida et al., 2015 ) and Sox9, along with other SoxE factors, promote progenitor and glial identity in a context- specific manner ( Weider and Wegner, 2017 ). By comparison, Hes1 and Hes5 , bHLH factors down-stream of Notch-signaling are repressed by Nfia and Nfib ( Piper et al., 2010 ). Hes1 and Hes5 promote specification of MG in developing rodent retinas ( Furukawa et al., 2000 ; Hojo et al., 2000 ; Ohtsuka et al., 2001 ). Similarly, NFIA has been shown to promote glial cell fate and favor astrocyte specification in the developing rodent brain ( Deneen et al., 2006 ; Namihira et al., 2009 ; Kang et al., 2012 ; Glasgow et al., 2014 ). Although the roles of NFIs in developing neural tissues have been well- established, the roles of NFIs in mature neurons and glia remains less certain. The conditional deletion of NFIA from mature astrocytes influences responses to injury ( Laug et al., 2019 ) and the activity of neuronal circuits ( Huang et al., 2020 ). We have recently reported that conditional deletion of Nfia, Nfib and Nfix from mouse MG permits the reprograming of these glia into neuron-like cells when retinas were damaged and treated with insulin and FGF2 ( Hoang et al., 2020 ). In the chick retina, we observed elevated levels of NFIA and NFIB in mature MG and lower levels in MGPCs, consistent with the hypothesis that these factors limit the neurogenic potential of MGPCs. For example, NFIA has been shown to promote glial cell fate and favor astrocyte specification in the developing rodent brain ( Deneen et al., 2006 ; Namihira et al., 2009 ; Kang et al., 2012 ; Glasgow et al., 2014 ). Other transcription factors that may limit neurogenic potential of neuronal progenitors can include Id1, Id4, Sox2, Sox8, Sox9, Sox10, Hes1 and Hes5 ( Imayoshi et al., 2013 ; Weider and Wegner, 2017 ; Akdemir et al., 2020 ). These factors are also expressed by chick MGPCs ( Palazzo et al., 2020 ; Campbell et al., 2021 ), suggesting redundancy and a network of transcription factors that act to maintain glial phenotype and suppress neuronal differentiation. Not surprisingly this network of pro-glial factors is not prominent in MGPCs in damaged zebrafish retinas ( Hoang et al., 2020 ). Conclusions NFIs are expressed by many different types of retinal neurons and glia during development and in mature retinas. NFI expression is maintained in some types of mature neurons and all types of glia, including oligodendrocytes, microglia and MG. Patterns of expression of NFIs are very similar in the retinas of chicks, pigs and monkeys. NFIA and NFIB are prominently expressed by MG in the retinas of all species, and likely at to maintain glial phenotype. In chick retinas, levels of NFIA and NFIB are down-regulated during activation and de-differentiation of MG and in proliferating MGPCs. Our findings are consistent with the notion that NFIs act to maintain phenotype in mature retina neurons and glia. Data availability RNA-Seq data for gene-cell matrices are deposited in GitHub https://github.com/jiewwwang/Single-cell-retinal-regeneration https://github.com/fischerlab3140/scRNAseq_libraries scRNA-Seq data can be queried at https://proteinpaint.stjude.org/F/2019.retina.scRNA.html . Author Contributions HME and WAC designed and executed experiments, prepared scRNA-seq libraries, performed bioinformatic analyses, gathered data and constructed figures. LEK and ECH executed experiments and gathered data. AJ and MAM provided pig retinas. MS and KM prepared scRNA-seq libraries for pig and monkey retinas.AJF designed experiments, analyzed data, performed bioinformatic analyses, constructed figures and wrote the manuscript. Acknowledgements This work was supported by RO1 EY022030-08, RO1 EY032141-01 (AJF) and RO1 EY026158 and Kentucky Lions Eye Research Endowed Chair (MAM). We thank Isabella Palazzo for comments and discussions that shaped the final form of the manuscript. Footnotes https://github.com/jiewwwang/Single-cell-retinal-regeneration https://github.com/fischerlab3140/scRNAseq_libraries References ↵ Akdemir ES , Huang AY-S , Deneen B . 2020 . Astrocytogenesis: where, when, and how . F1000Res 9 . ↵ Bernardos RL , Lentz SI , Wolfe MS , Raymond PA . 2005 . Notch-Delta signaling is required for spatial patterning and Muller glia differentiation in the zebrafish retina . Dev Biol 278 : 381 – 95 . OpenUrl CrossRef PubMed Web of Science ↵ Brunet N , Tarabal O , Portero-Otín M , Oppenheim RW , Esquerda JE , Calderó J . 2007 . Survival and death of mature avian motoneurons in organotypic slice culture: trophic requirements for survival and different types of degeneration . J Comp Neurol 501 : 669 – 690 . OpenUrl CrossRef PubMed Web of Science ↵ Butler A , Hoffman P , Smibert P , Papalexi E , Satija R . 2018 . Integrating single-cell transcriptomic data across different conditions, technologies, and species . Nature Biotechnology 36 : 411 – 420 . OpenUrl CrossRef PubMed ↵ Campbell WA , Deshmukh A , Blum S , Todd L , Mendonca N , Weist J , Zent J , Hoang TV , Blackshaw S , Leight J , Fischer AJ . 2019 . Matrix-metalloproteinase expression and gelatinase activity in the avian retina and their influence on Müller glia proliferation . Exp Neurol 320 : 112984 . OpenUrl ↵ Campbell WA , Fritsch-Kelleher A , Palazzo I , Hoang T , Blackshaw S , Fischer AJ . 2021 . Midkine is neuroprotective and influences glial reactivity and the formation of Müller glia-derived progenitor cells in chick and mouse retinas . Glia . ↵ Clark BS , Stein-O’Brien GL , Shiau F , Cannon GH , Davis-Marcisak E , Sherman T , Santiago CP , Hoang TV , Rajaii F , James-Esposito RE , Gronostajski RM , Fertig EJ , Goff LA , Blackshaw S . 2019 . Single-Cell RNA-Seq Analysis of Retinal Development Identifies NFI Factors as Regulating Mitotic Exit and Late-Born Cell Specification . Neuron 102 : 1111 – 1126 .e5. OpenUrl ↵ Close JL , Gumuscu B , Reh TA . 2005 . Retinal neurons regulate proliferation of postnatal progenitors and Muller glia in the rat retina via TGF beta signaling . Development 132 : 3015 – 26 . OpenUrl Abstract / FREE Full Text ↵ Cuadros MA , Santos AM , Martin-Oliva D , Calvente R , Tassi M , Marin-Teva JL , Navascues J . 2006 . Specific immunolabeling of brain macrophages and microglial cells in the developing and mature chick central nervous system . J Histochem Cytochem 54 : 727 – 38 . OpenUrl CrossRef PubMed ↵ Deneen B , Ho R , Lukaszewicz A , Hochstim CJ , Gronostajski RM , Anderson DJ . 2006 . The transcription factor NFIA controls the onset of gliogenesis in the developing spinal cord . Neuron 52 : 953 – 968 . OpenUrl CrossRef PubMed Web of Science ↵ Fischer AJ , Dierks BD , Reh TA . 2002a . Exogenous growth factors induce the production of ganglion cells at the retinal margin . Development 129 : 2283 – 2291 . OpenUrl Abstract / FREE Full Text ↵ Fischer AJ , Foster S , Scott MA , Sherwood P . 2008 . Transient expression of LIM-domain transcription factors is coincident with delayed maturation of photoreceptors in the chicken retina . J Comp Neurol 506 : 584 – 603 . OpenUrl CrossRef PubMed ↵ Fischer AJ , McGuire CR , Dierks BD , Reh TA . 2002b . Insulin and fibroblast growth factor 2 activate a neurogenic program in Müller glia of the chicken retina . J Neurosci 22 : 9387 – 9398 . OpenUrl Abstract / FREE Full Text ↵ Fischer AJ , Omar G , Eubanks J , McGuire CR , Dierks BD , Reh TA . 2004 . Different aspects of gliosis in retinal Muller glia can be induced by CNTF, insulin, and FGF2 in the absence of damage . Mol Vis 10 : 973 – 986 . OpenUrl PubMed Web of Science ↵ Fischer AJ , Reh TA . 2000 . Identification of a proliferating marginal zone of retinal progenitors in postnatal chickens . Dev Biol 220 : 197 – 210 . OpenUrl CrossRef PubMed Web of Science ↵ Fischer AJ , Reh TA . 2002 . Exogenous growth factors stimulate the regeneration of ganglion cells in the chicken retina . Dev Biol 251 : 367 – 379 . OpenUrl CrossRef PubMed Web of Science ↵ Fischer AJ , Reh TA . 2003 . Growth factors induce neurogenesis in the ciliary body . Dev Biol 259 : 225 – 240 . OpenUrl CrossRef PubMed Web of Science ↵ Fischer AJ , Scott MA , Ritchey ER , Sherwood P . 2009 . Mitogen-activated protein kinase- signaling regulates the ability of Müller glia to proliferate and protect retinal neurons against excitotoxicity . Glia 57 : 1538 – 1552 . OpenUrl CrossRef PubMed Web of Science ↵ Fischer AJ , Scott MA , Zelinka C , Sherwood P . 2010a . A novel type of glial cell in the retina is stimulated by insulin-like growth factor 1 and may exacerbate damage to neurons and Müller glia . Glia 58 : 633 – 649 . OpenUrl ↵ Fischer AJ , Seltner RLP , Poon J , Stell WK . 1998 . Immunocytochemical characterization of quisqualic acid- and N-methyl-D-aspartate-induced excitotoxicity in the retina of chicks . Journal of Comparative Neurology 393 : 1 – 15 . OpenUrl CrossRef PubMed Web of Science ↵ Fischer AJ , Stanke JJ , Aloisio G , Hoy H , Stell WK . 2007 . Heterogeneity of horizontal cells in the chicken retina . J Comp Neurol 500 : 1154 – 1171 . OpenUrl CrossRef PubMed Web of Science ↵ Fischer AJ , Zelinka C , Gallina D , Scott MA , Todd L . 2014 . Reactive microglia and macrophage facilitate the formation of Müller glia-derived retinal progenitors . Glia 62 : 1608 – 1628 . OpenUrl ↵ Fischer AJ , Zelinka C , Scott MA . 2010b . Heterogeneity of glia in the retina and optic nerve of birds and mammals . PLoS ONE 5 : e10774 . OpenUrl CrossRef PubMed ↵ Furukawa T , Mukherjee S , Bao ZZ , Morrow EM , Cepko CL . 2000 . rax, Hes1, and notch1 promote the formation of Muller glia by postnatal retinal progenitor cells . Neuron 26 : 383 – 94 . OpenUrl CrossRef PubMed Web of Science ↵ Gallina D , Zelinka C , Fischer AJ . 2014 . Glucocorticoid receptors in the retina, Müller glia and the formation of Müller glia-derived progenitors . Development 141 : 3340 – 3351 . OpenUrl Abstract / FREE Full Text ↵ Ghai K , Stanke JJ , Fischer AJ . 2008 . Patterning of the circumferential marginal zone of progenitors in the chicken retina . Brain Res 1192 : 76 – 89 . OpenUrl CrossRef PubMed Web of Science ↵ Ghai K , Zelinka C , Fischer AJ . 2009 . Serotonin released from amacrine neurons is scavenged and degraded in bipolar neurons in the retina . J Neurochem 111 : 1 – 14 . OpenUrl CrossRef PubMed Web of Science ↵ Ghai K , Zelinka C , Fischer AJ . 2010 . Notch signaling influences neuroprotective and proliferative properties of mature Müller glia . J Neurosci 30 : 3101 – 3112 . OpenUrl Abstract / FREE Full Text ↵ Glasgow SM , Zhu W , Stolt CC , Huang T-W , Chen F , LoTurco JJ , Neul JL , Wegner M , Mohila C , Deneen B . 2014 . Mutual antagonism between Sox10 and NFIA regulates diversification of glial lineages and glioma subtypes . Nat Neurosci 17 : 1322 – 1329 . OpenUrl CrossRef PubMed ↵ Goldman D . 2014 . Müller glial cell reprogramming and retina regeneration . Nature Reviews Neuroscience 15 : 431 – 442 . OpenUrl CrossRef PubMed ↵ Gordon WC , Casey DM , Lukiw WJ , Bazan NG . 2002 . DNA damage and repair in light- induced photoreceptor degeneration . Invest Ophthalmol Vis Sci 43 : 3511 – 21 . OpenUrl Abstract / FREE Full Text Hamburger V Hamilton , HL. 1951 . A series of normal stages in the development of the chick embryo . Journal of Morphology 88 : 49 – 92 . OpenUrl CrossRef PubMed Web of Science ↵ Harris L , Genovesi LA , Gronostajski RM , Wainwright BJ , Piper M . 2015 . Nuclear factor one transcription factors: Divergent functions in developmental versus adult stem cell populations . Dev Dyn 244 : 227 – 238 . OpenUrl CrossRef ↵ Hayes S , Nelson BR , Buckingham B , Reh TA . 2007 . Notch signaling regulates regeneration in the avian retina . Dev Biol 312 : 300 – 11 . OpenUrl CrossRef PubMed Web of Science ↵ Heng YHE , McLeay RC , Harvey TJ , Smith AG , Barry G , Cato K , Plachez C , Little E , Mason S , Dixon C , Gronostajski RM , Bailey TL , Richards LJ , Piper M . 2014 . NFIX regulates neural progenitor cell differentiation during hippocampal morphogenesis . Cereb Cortex 24 : 261 – 279 . OpenUrl CrossRef PubMed Web of Science ↵ Hoang T , Wang J , Boyd P , Wang F , Santiago C , Jiang L , Yoo S , Lahne M , Todd LJ , Jia M , Saez C , Keuthan C , Palazzo I , Squires N , Campbell WA , Rajaii F , Parayil T , Trinh V , Kim DW , Wang G , Campbell LJ , Ash J , Fischer AJ , Hyde DR , Qian J , Blackshaw S . 2020 . Gene regulatory networks controlling vertebrate retinal regeneration . Science 370 . ↵ Hojo M , Ohtsuka T , Hashimoto N , Gradwohl G , Guillemot F , Kageyama R . 2000 . Glial cell fate specification modulated by the bHLH gene Hes5 in mouse retina . Development 127 : 2515 – 22 . OpenUrl Abstract ↵ Huang AY-S , Woo J , Sardar D , Lozzi B , Bosquez Huerta NA , Lin C-CJ , Felice D , Jain A , Paulucci-Holthauzen A , Deneen B . 2020 . Region-Specific Transcriptional Control of Astrocyte Function Oversees Local Circuit Activities . Neuron 106 : 992 – 1008 .e9. OpenUrl ↵ Iida A , Iwagawa T , Baba Y , Satoh S , Mochizuki Y , Nakauchi H , Furukawa T , Koseki H , Murakami A , Watanabe S . 2015 . Roles of histone H3K27 trimethylase Ezh2 in retinal proliferation and differentiation . Dev Neurobiol 75 : 947 – 60 . OpenUrl CrossRef ↵ Imayoshi I , Isomura A , Harima Y , Kawaguchi K , Kori H , Miyachi H , Fujiwara T , Ishidate F , Kageyama R . 2013 . Oscillatory control of factors determining multipotency and fate in mouse neural progenitors . Science 342 : 1203 – 8 . OpenUrl Abstract / FREE Full Text ↵ Jorstad NL , Wilken MS , Todd L , Finkbeiner C , Nakamura P , Radulovich N , Hooper MJ , Chitsazan A , Wilkerson BA , Rieke F , Reh TA . 2020 . STAT Signaling Modifies Ascl1 Chromatin Binding and Limits Neural Regeneration from Muller Glia in Adult Mouse Retina . Cell Rep 30 : 2195 – 2208 .e5. OpenUrl ↵ Kang P , Lee HK , Glasgow SM , Finley M , Donti T , Gaber ZB , Graham BH , Foster AE , Novitch BG , Gronostajski RM , Deneen B . 2012 . Sox9 and NFIA coordinate a transcriptional regulatory cascade during the initiation of gliogenesis . Neuron 74 : 79 – 94 . OpenUrl CrossRef PubMed Web of Science ↵ Keeley PW , Reese BE . 2018 . DNER and NFIA are expressed by developing and mature AII amacrine cells in the mouse retina . J Comp Neurol 526 : 467 – 479 . OpenUrl CrossRef PubMed ↵ Kruchkova Y , Ben-Dror I , Herschkovitz A , David M , Yayon A , Vardimon L . 2001 . Basic fibroblast growth factor: a potential inhibitor of glutamine synthetase expression in injured neural tissue . J Neurochem 77 : 1641 – 9 . OpenUrl CrossRef PubMed Web of Science ↵ Laug D , Huang T-W , Huerta NAB , Huang AY-S , Sardar D , Ortiz-Guzman J , Carlson JC , Arenkiel BR , Kuo CT , Mohila CA , Glasgow SM , Lee HK , Deneen B . 2019 . Nuclear factor I-A regulates diverse reactive astrocyte responses after CNS injury . J Clin Invest 129 : 4408 – 4418 . OpenUrl ↵ Lee M-S , Wan J , Goldman D . 2020 . Tgfb3 collaborates with PP2A and notch signaling pathways to inhibit retina regeneration . Elife 9 . ↵ Lenkowski JR , Qin Z , Sifuentes CJ , Thummel R , Soto CM , Moens CB , Raymond PA . 2013 . Retinal regeneration in adult zebrafish requires regulation of TGFbeta signaling . Glia 61 : 1687 – 97 . OpenUrl CrossRef PubMed ↵ Ma W , Silverman SM , Zhao L , Villasmil R , Campos MM , Amaral J , Wong WT . 2019 . Absence of TGFβ signaling in retinal microglia induces retinal degeneration and exacerbates choroidal neovascularization . Elife 8 . ↵ Namihira M , Kohyama J , Semi K , Sanosaka T , Deneen B , Taga T , Nakashima K . 2009 . Committed neuronal precursors confer astrocytic potential on residual neural precursor cells . Dev Cell 16 : 245 – 55 . OpenUrl CrossRef PubMed Web of Science ↵ Ohtsuka T , Sakamoto M , Guillemot F , Kageyama R . 2001 . Roles of the basic helix-loop- helix genes Hes1 and Hes5 in expansion of neural stem cells of the developing brain . J Biol Chem 276 : 30467 – 74 . OpenUrl Abstract / FREE Full Text ↵ Palazzo I , Deistler K , Hoang TV , Blackshaw S , Fischer AJ . 2020 . NF-κB signaling regulates the formation of proliferating Müller glia-derived progenitor cells in the avian retina . Development 147 . ↵ Piper M , Barry G , Hawkins J , Mason S , Lindwall C , Little E , Sarkar A , Smith AG , Moldrich RX , Boyle GM , Tole S , Gronostajski RM , Bailey TL , Richards LJ . 2010 . NFIA controls telencephalic progenitor cell differentiation through repression of the Notch effector Hes1 . J Neurosci 30 : 9127 – 9139 . OpenUrl Abstract / FREE Full Text ↵ Poche RA , Furuta Y , Chaboissier MC , Schedl A , Behringer RR . 2008 . Sox9 is expressed in mouse multipotent retinal progenitor cells and functions in Muller glial cell development . J Comp Neurol 510 : 237 – 50 . OpenUrl CrossRef PubMed Web of Science ↵ Qiu X , Hill A , Packer J , Lin D , Ma Y-A , Trapnell C . 2017a . Single-cell mRNA quantification and differential analysis with Census . Nature Methods 14 : 309 – 315 . OpenUrl Qiu X , Mao Q , Tang Y , Wang L , Chawla R , Pliner HA , Trapnell C . 2017b . Reversed graph embedding resolves complex single-cell trajectories . Nature Methods 14 : 979 – 982 . OpenUrl ↵ Reichenbach A , Bringmann A . 2013 . New functions of Müller cells . Glia 61 : 651 – 678 . OpenUrl CrossRef PubMed ↵ Rompani SB , Cepko CL . 2010 . A common progenitor for retinal astrocytes and oligodendrocytes . J Neurosci 30 : 4970 – 80 . OpenUrl Abstract / FREE Full Text ↵ van Rooijen N. 1992 . Liposome-mediated elimination of macrophages . Res Immunol 143 : 215 – 9 . OpenUrl CrossRef PubMed Web of Science ↵ Satija R , Farrell JA , Gennert D , Schier AF , Regev A . 2015 . Spatial reconstruction of single-cell gene expression data . Nat Biotechnol 33 : 495 – 502 . OpenUrl CrossRef PubMed ↵ Sigulinsky CL , Green ES , Clark AM , Levine EM . 2008 . Vsx2/Chx10 ensures the correct timing and magnitude of Hedgehog signaling in the mouse retina . Dev Biol 317 : 560 – 575 . OpenUrl CrossRef PubMed Web of Science ↵ Stanke J , Moose HE , El-Hodiri HM , Fischer AJ . 2010 . Comparative study of Pax2 expression in glial cells in the retina and optic nerve of birds and mammals . J Comp Neurol 518 : 2316 – 2333 . OpenUrl CrossRef PubMed Web of Science ↵ Stanke JJ , Lehman B , Fischer AJ . 2008 . Muscarinic signaling influences the patterning and phenotype of cholinergic amacrine cells in the developing chick retina . BMC Dev Biol 8 : 13 . OpenUrl CrossRef PubMed ↵ Tappeiner C , Maurer E , Sallin P , Bise T , Enzmann V , Tschopp M . 2016 . Inhibition of the TGFβ Pathway Enhances Retinal Regeneration in Adult Zebrafish . PLoS One 11 : e0167073 . OpenUrl ↵ Todd L , Finkbeiner C , Wong CK , Hooper MJ , Reh TA . 2020 . Microglia Suppress Ascl1- Induced Retinal Regeneration in Mice . Cell Rep 33 : 108507 . OpenUrl ↵ Todd L , Fischer AJ . 2015 . Hedgehog signaling stimulates the formation of proliferating Müller glia-derived progenitor cells in the chick retina . Development 142 : 2610 – 2622 . OpenUrl Abstract / FREE Full Text ↵ Todd L , Palazzo I , Squires N , Mendonca N , Fischer AJ . 2017a . BMP- and TGFβ- signaling regulate the formation of Müller glia-derived progenitor cells in the avian retina . Glia 65 : 1640 – 1655 . OpenUrl CrossRef ↵ Todd L , Squires N , Suarez L , Fischer AJ. 2016a . Jak/Stat signaling regulates the proliferation and neurogenic potential of Müller glia-derived progenitor cells in the avian retina . Sci Rep [Internet] 6. Available from: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5069623/ ↵ Todd L , Suarez L , Quinn C , Fischer AJ . 2018 . Retinoic Acid-Signaling Regulates the Proliferative and Neurogenic Capacity of Müller Glia-Derived Progenitor Cells in the Avian Retina . STEM CELLS 36 : 392 – 405 . OpenUrl CrossRef ↵ Todd L , Suarez L , Squires N , Zelinka CP , Gribbins K , Fischer AJ . 2016b . Comparative analysis of glucagonergic cells, glia, and the circumferential marginal zone in the reptilian retina . J Comp Neurol 524 : 74 – 89 . OpenUrl CrossRef ↵ Trapnell C , Roberts A , Goff L , Pertea G , Kim D , Kelley DR , Pimentel H , Salzberg SL , Rinn JL , Pachter L . 2012 . Differential gene and transcript expression analysis of RNA-seq experiments with TopHat and Cufflinks . Nat Protoc 7 : 562 – 78 . OpenUrl CrossRef PubMed ↵ Van Rooijen N. 1989 . The liposome-mediated macrophage ‘suicide’ technique . Journal of Immunological Methods 124 : 1 – 6 . OpenUrl CrossRef PubMed Web of Science ↵ Vetter ML , Moore KB . 2001 . Becoming glial in the neural retina . Dev Dyn 221 : 146 – 53 . OpenUrl CrossRef PubMed Web of Science ↵ Weider M , Wegner M . 2017 . SoxE factors: Transcriptional regulators of neural differentiation and nervous system development . Semin Cell Dev Biol 63 : 35 – 42 . OpenUrl CrossRef PubMed ↵ Wilczynska KM , Singh SK , Adams B , Bryan L , Rao RR , Valerie K , Wright S , Griswold- Prenner I , Kordula T . 2009 . Nuclear factor I isoforms regulate gene expression during the differentiation of human neural progenitors to astrocytes . Stem Cells 27 : 1173 – 1181 . OpenUrl CrossRef PubMed Web of Science ↵ Wright E , Hargrave MR , Christiansen J , Cooper L , Kun J , Evans T , Gangadharan U , Greenfield A , Koopman P . 1995 . The Sry-related gene Sox9 is expressed during chondrogenesis in mouse embryos . Nat Genet 9 : 15 – 20 . OpenUrl CrossRef PubMed Web of Science ↵ Xiang M , Gan L , Zhou L , Klein WH , Nathans J . 1996 . Targeted deletion of the mouse POU domain gene Brn-3a causes selective loss of neurons in the brainstem and trigeminal ganglion, uncoordinated limb movement, and impaired suckling . Proc Natl Acad Sci U S A 93 : 11950 – 11955 . OpenUrl Abstract / FREE Full Text ↵ Xiang M , Zhou L , Macke JP , Yoshioka T , Hendry SH , Eddy RL , Shows TB , Nathans J . 1995 . The Brn-3 family of POU-domain factors: primary structure, binding specificity, and expression in subsets of retinal ganglion cells and somatosensory neurons . J Neurosci 15 : 4762 – 4785 . OpenUrl Abstract / FREE Full Text ↵ Yamagata M , Yan W , Sanes JR . 2021 . A cell atlas of the chick retina based on single- cell transcriptomics . Elife 10 . ↵ Zelinka CP , Scott MA , Volkov L , Fischer AJ . 2012 . The Reactivity, Distribution and Abundance of Non-Astrocytic Inner Retinal Glial (NIRG) Cells Are Regulated by Microglia, Acute Damage, and IGF1 . PLOS ONE 7 : e44477 . OpenUrl CrossRef PubMed ↵ Zelinka CP , Volkov L , Goodman ZA , Todd L , Palazzo I , Bishop WA , Fischer AJ . 2016 . mTor signaling is required for the formation of proliferating Müller glia-derived progenitor cells in the chick retina . Development 143 : 1859 – 1873 . OpenUrl Abstract / FREE Full Text Back to top Previous Next Posted July 14, 2021. Download PDF Data/Code Email Thank you for your interest in spreading the word about bioRxiv. NOTE: Your email address is requested solely to identify you as the sender of this article. Your Email * Your Name * Send To * Enter multiple addresses on separate lines or separate them with commas. You are going to email the following Nuclear Factor I in neurons, glia and during the formation of Müller glia-derived progenitor cells in avian, porcine and primate retinas Message Subject (Your Name) has forwarded a page to you from bioRxiv Message Body (Your Name) thought you would like to see this page from the bioRxiv website. Your Personal Message CAPTCHA This question is for testing whether or not you are a human visitor and to prevent automated spam submissions. Share Nuclear Factor I in neurons, glia and during the formation of Müller glia-derived progenitor cells in avian, porcine and primate retinas Heithem M. El-Hodiri , Warren A. Campbell , Lisa E. Kelly , Evan C. Hawthorn , Maura Schwartz , Archana Jalligampala , Maureen A. McCall , Kathrin Meyer , Andy J. Fischer bioRxiv 2021.07.13.451621; doi: https://doi.org/10.1101/2021.07.13.451621 Share This Article: Copy Citation Tools Nuclear Factor I in neurons, glia and during the formation of Müller glia-derived progenitor cells in avian, porcine and primate retinas Heithem M. El-Hodiri , Warren A. Campbell , Lisa E. Kelly , Evan C. Hawthorn , Maura Schwartz , Archana Jalligampala , Maureen A. McCall , Kathrin Meyer , Andy J. Fischer bioRxiv 2021.07.13.451621; doi: https://doi.org/10.1101/2021.07.13.451621 Citation Manager Formats BibTeX Bookends EasyBib EndNote (tagged) EndNote 8 (xml) Medlars Mendeley Papers RefWorks Tagged Ref Manager RIS Zotero Tweet Widget Facebook Like Google Plus One Subject Area Neuroscience Subject Areas All Articles Animal Behavior and Cognition (7970) Biochemistry (18639) Bioengineering (14770) Bioinformatics (44164) Biophysics (22465) Cancer Biology (19598) Cell Biology (26759) Clinical Trials (138) Developmental Biology (13904) Ecology (20894) Epidemiology (2067) Evolutionary Biology (25324) Genetics (16100) Genomics (23404) Immunology (18610) Microbiology (42249) Molecular Biology (17950) Neuroscience (92902) Paleontology (693) Pathology (2970) Pharmacology and Toxicology (5063) Physiology (8068) Plant Biology (15913) Scientific Communication and Education (2092) Synthetic Biology (4538) Systems Biology (10190) Zoology (2376) window.__CF$cv$params={r:'a37e9c5c8eebde16',t:'MTc4ODg3NzQwMw==',u:'01a0816731f57e53bef4b9fee319cbb7',ut:'jU2xqoat2USGHASYT2KVKWoQ5vXQgkius6U6WZnUi.M-1788877418-1.2.1.1-u3mzz9XgnTgXRR2tPjZOCg.zcrWQ7JLY.hq4wVJ1dHnz18UVqYTM.iU7DJa_7oU5UR5VvmJGIXygn.BQzN0cIkYndyJRss02rQbQ1R7ig3s',i:60};(function(){if(!document.body)return;var s=document.createElement('script');s.src='/cdn-cgi/challenge-platform/scripts/precursor/main.js';document.head.appendChild(s);})();

Text is read by the "Ask this paper" AI Q&A widget below. Extraction quality varies by source — PMC NXML preserves structure cleanly, OA-HTML may include some navigation residue, and OA-PDF can have broken hyphenation. The publisher copy (via DOI) is the canonical version.

My notes (saved in your browser only)

⚙ Ask this paper AI returns verbatim quotes from the full text · source: preprint-html ⓘ

Answers must be backed by verbatim quotes from this paper's full text. Hallucinated quotes are dropped automatically; if no verbatim passage answers the question, we say so. How this works

Citation neighborhood (no data yet)

We don't have any in-corpus citations linked to this paper yet. The paper's references may be in our DB but unresolved to ``paper_id`` (resolution happens at ingest when the cited DOI matches a row we already have). Run the cross-source citation reconcile pass to retry.

Source provenance

europepmc
last seen: 2026-05-19T01:45:01.086888+00:00
unpaywall
last seen: 2026-10-03T06:31:36.481334+00:00