Harnessing Microbial Tools:Escherichia coli as a Vehicle for Neuropeptide Functional Analysis in Caenorhabditis elegans

preprint OA: closed
📄 Open PDF Full text JSON View at publisher

Abstract

Animals respond to changes in their environment and internal states via neuromodulation. Neuropeptides modulate neural circuits with flexibility because one gene can produce either multiple copies of the same neuropeptide or different neuropeptides. However, with this architectural complexity, the function of discrete and active neuropeptides is muddled. Here, we design a genetic tool that facilitates functional analysis of individual peptides. We engineered Escherichia coli bacteria to express active peptides, fed loss-of-function Caenorhabditis elegans , and rescued the activity of genes with varying lengths and functions: pdf-1, flp-3, ins-6 , and ins-22 . Some peptides were functionally redundant, while others exhibit unique and previously uncharacterized functions. We postulate our rescue-by-feeding approach can elucidate the functional landscape of neuropeptides, identifying the circuits and complex peptidergic pathways that regulate different behavioral and physiological processes. Article summary Studying individual neuropeptides opens new avenues for exploring neuromodulation at a finer resolution. The researchers developed a method to create DNA vectors that encode an endogenous peptide sequence flanked by sequences containing dibasic endopeptidase cleavage sites in Caenorhabditis elegans . The researchers transformed these vectors into bacteria and fed them to C. elegans , which restored wildtype behavior in neuropeptide loss-of-function mutants. The researchers also discovered that neuropeptides from the same gene perform distinct functions, a research area more ready to explore using the presented technology. Graphical Abstract Created in BioRender. DiLoreto, E. (2025) https://BioRender.com/ypbrtlk
Full text 96,055 characters · extracted from preprint-html · click to expand
Harnessing Microbial Tools: Escherichia coli as a Vehicle for Neuropeptide Functional Analysis in Caenorhabditis elegans | bioRxiv /* */ /* */ <!-- <!-- /*! * yepnope1.5.4 * (c) WTFPL, GPLv2 */ (function(a,b,c){function d(a){return"[object Function]"==o.call(a)}function e(a){return"string"==typeof a}function f(){}function g(a){return!a||"loaded"==a||"complete"==a||"uninitialized"==a}function h(){var a=p.shift();q=1,a?a.t?m(function(){("c"==a.t?B.injectCss:B.injectJs)(a.s,0,a.a,a.x,a.e,1)},0):(a(),h()):q=0}function i(a,c,d,e,f,i,j){function k(b){if(!o&&g(l.readyState)&&(u.r=o=1,!q&&h(),l.onload=l.onreadystatechange=null,b)){"img"!=a&&m(function(){t.removeChild(l)},50);for(var d in y[c])y[c].hasOwnProperty(d)&&y[c][d].onload()}}var j=j||B.errorTimeout,l=b.createElement(a),o=0,r=0,u={t:d,s:c,e:f,a:i,x:j};1===y[c]&&(r=1,y[c]=[]),"object"==a?l.data=c:(l.src=c,l.type=a),l.width=l.height="0",l.onerror=l.onload=l.onreadystatechange=function(){k.call(this,r)},p.splice(e,0,u),"img"!=a&&(r||2===y[c]?(t.insertBefore(l,s?null:n),m(k,j)):y[c].push(l))}function j(a,b,c,d,f){return q=0,b=b||"j",e(a)?i("c"==b?v:u,a,b,this.i++,c,d,f):(p.splice(this.i++,0,a),1==p.length&&h()),this}function k(){var a=B;return a.loader={load:j,i:0},a}var l=b.documentElement,m=a.setTimeout,n=b.getElementsByTagName("script")[0],o={}.toString,p=[],q=0,r="MozAppearance"in l.style,s=r&&!!b.createRange().compareNode,t=s?l:n.parentNode,l=a.opera&&"[object Opera]"==o.call(a.opera),l=!!b.attachEvent&&!l,u=r?"object":l?"script":"img",v=l?"script":u,w=Array.isArray||function(a){return"[object Array]"==o.call(a)},x=[],y={},z={timeout:function(a,b){return b.length&&(a.timeout=b[0]),a}},A,B;B=function(a){function b(a){var a=a.split("!"),b=x.length,c=a.pop(),d=a.length,c={url:c,origUrl:c,prefixes:a},e,f,g;for(f=0;f<d;f++)g=a[f].split("="),(e=z[g.shift()])&&(c=e(c,g));for(f=0;f<b;f++)c=x[f](c);return c}function g(a,e,f,g,h){var i=b(a),j=i.autoCallback;i.url.split(".").pop().split("?").shift(),i.bypass||(e&&(e=d(e)?e:e[a]||e[g]||e[a.split("/").pop().split("?")[0]]),i.instead?i.instead(a,e,f,g,h):(y[i.url]?i.noexec=!0:y[i.url]=1,f.load(i.url,i.forceCSS||!i.forceJS&&"css"==i.url.split(".").pop().split("?").shift()?"c":c,i.noexec,i.attrs,i.timeout),(d(e)||d(j))&&f.load(function(){k(),e&&e(i.origUrl,h,g),j&&j(i.origUrl,h,g),y[i.url]=2})))}function h(a,b){function c(a,c){if(a){if(e(a))c||(j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}),g(a,j,b,0,h);else if(Object(a)===a)for(n in m=function(){var b=0,c;for(c in a)a.hasOwnProperty(c)&&b++;return b}(),a)a.hasOwnProperty(n)&&(!c&&!--m&&(d(j)?j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}:j[n]=function(a){return function(){var b=[].slice.call(arguments);a&&a.apply(this,b),l()}}(k[n])),g(a[n],j,b,n,h))}else!c&&l()}var h=!!a.test,i=a.load||a.both,j=a.callback||f,k=j,l=a.complete||f,m,n;c(h?a.yep:a.nope,!!i),i&&c(i)}var i,j,l=this.yepnope.loader;if(e(a))g(a,0,l,0);else if(w(a))for(i=0;i (function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0];var j=d.createElement(s);var dl=l!='dataLayer'?'&l='+l:'';j.src='//www.googletagmanager.com/gtm.js?id='+i+dl;j.type='text/javascript';j.async=true;f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-M677548'); Skip to main content Home About Submit ALERTS / RSS Search for this keyword Advanced Search New Results Harnessing Microbial Tools: Escherichia coli as a Vehicle for Neuropeptide Functional Analysis in Caenorhabditis elegans Elizabeth M. DiLoreto , Shruti Shastry , Emily J. Leptich , View ORCID Profile Douglas K. Reilly , View ORCID Profile Rachel N. Arey , View ORCID Profile Jagan Srinivasan doi: https://doi.org/10.1101/2025.03.03.641308 Elizabeth M. DiLoreto 1 Department of Biology and Biotechnology, Worcester Polytechnic Institute, 100 Institute Drive , Worcester, MA, USA , 01609 Find this author on Google Scholar Find this author on PubMed Search for this author on this site Shruti Shastry 1 Department of Biology and Biotechnology, Worcester Polytechnic Institute, 100 Institute Drive , Worcester, MA, USA , 01609 Find this author on Google Scholar Find this author on PubMed Search for this author on this site Emily J. Leptich 2 Department of Molecular and Cellular Biology, Baylor College of Medicine , 6450 E Cullen St, Houston, TX, USA 77030 Find this author on Google Scholar Find this author on PubMed Search for this author on this site Douglas K. Reilly 1 Department of Biology and Biotechnology, Worcester Polytechnic Institute, 100 Institute Drive , Worcester, MA, USA , 01609 3 Current Position: Department of Biology, Tufts University , Medford, MA, USA Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Douglas K. Reilly Rachel N. Arey 2 Department of Molecular and Cellular Biology, Baylor College of Medicine , 6450 E Cullen St, Houston, TX, USA 77030 Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Rachel N. Arey Jagan Srinivasan 1 Department of Biology and Biotechnology, Worcester Polytechnic Institute, 100 Institute Drive , Worcester, MA, USA , 01609 4 Neuroscience Program, Worcester Polytechnic Institute , Worcester, MA, USA Find this author on Google Scholar Find this author on PubMed Search for this author on this site ORCID record for Jagan Srinivasan For correspondence: jsrinivasan{at}wpi.edu Abstract Full Text Info/History Metrics Data/Code Preview PDF Abstract Animals respond to changes in their environment and internal states via neuromodulation. Neuropeptides modulate neural circuits with flexibility because one gene can produce either multiple copies of the same neuropeptide or different neuropeptides. However, with this architectural complexity, the function of discrete and active neuropeptides is muddled. Here, we design a genetic tool that facilitates functional analysis of individual peptides. We engineered Escherichia coli bacteria to express active peptides, fed loss-of-function Caenorhabditis elegans , and rescued the activity of genes with varying lengths and functions: pdf-1, flp-3, ins-6 , and ins-22 . Some peptides were functionally redundant, while others exhibit unique and previously uncharacterized functions. We postulate our rescue-by-feeding approach can elucidate the functional landscape of neuropeptides, identifying the circuits and complex peptidergic pathways that regulate different behavioral and physiological processes. Article summary Studying individual neuropeptides opens new avenues for exploring neuromodulation at a finer resolution. The researchers developed a method to create DNA vectors that encode an endogenous peptide sequence flanked by sequences containing dibasic endopeptidase cleavage sites in Caenorhabditis elegans . The researchers transformed these vectors into bacteria and fed them to C. elegans , which restored wildtype behavior in neuropeptide loss-of-function mutants. The researchers also discovered that neuropeptides from the same gene perform distinct functions, a research area more ready to explore using the presented technology. Download figure Open in new tab Created in BioRender. DiLoreto, E. (2025) https://BioRender.com/ypbrtlk Introduction The modulation of neural circuits is essential for life, as appropriate responses to environmental stimuli depend on precise neural tuning. Neuropeptides, which are relatively short amino acid chains (less than 100 amino acids), play a crucial role in this process by regulating neural circuits while also functioning as neurotransmitters or neurohormones [ 1 , 2 ]. They are widely used across the animal kingdom, even in organisms that possess only secretory cells without neurons [ 3 ]. Neuropeptides can also have conserved structure across species while serving a variety of functions. Oxytocin-like and vasopressin-like peptides are ancient neurohormones that regulate social attachment, lactation, and blood pressure in mammals [ 4 – 9 ]. However, in the Echinoderm sea star, Asterias rubens , the vasopressin-like and oxytocin-like neuropeptide ortholog, asterotocin, serves instead to relax muscles in the cardiac stomach during fictive feeding[ 9 ]. The Caenorhabditis elegans vasopressin ortholog, nematocin, interacts with serotonin and dopamine signaling to modulate gustatory associative memory and male mating behaviors [ 4 , 10 ]. Neuropeptides act in conjunction with neurotransmitters, typically binding to G-protein coupled receptors, where they modulate synaptic activity more slowly and over a longer duration than neurotransmitters alone [ 2 , 11 ]. Multiple modulators enable neurons to serve distinct functions within specific neural circuits [ 12 ]. Beyond the nervous system, neuropeptides also regulate immune and endocrine functions [ 13 , 14 ]. In humans, there are varying reports of 90 or 131 neuropeptide precursor genes, yet all studies agree that there are likely more neuropeptides in the 900 other peptide genes [ 15 – 18 ]. Post-transcriptional modifications can give rise to an even greater number of functional neuropeptides, numbering in the thousands [ 15 – 19 ]. This complexity is even seen in a “simpler” model organism, the roundworm Caenorhabditis elegans . C. elegans is a microscopic nematode that displays robust behaviors driven by just over 300 neurons [ 20 , 21 ]. The C. elegans genome encodes three classes of neuropeptides-FMRFamide-like peptides (FLP), insulin-like peptides (INS), and non-FLP/insulin neuropeptide-like peptides (NLP) [ 22 – 24 ]- and encodes over 300 individual neuropeptides through 160 identified genes that modulate the functional connectome [ 1 , 19 , 25 , 26 ]. The complexity of the neuropeptide genome, combined with extra-synaptic neuropeptide signaling, makes elucidating the role of individual peptides difficult, as canonical studies often rely on null mutations and transgenic rescues [ 27 – 30 ]. In particular, full gene rescue restores complete preproproteins and makes discrimination of discrete peptide function difficult [ 1 , 31 ]. Previous approaches to study individual endogenous neuropeptide function involved using synthetic peptides applied by soaking the nervous system of the worm [ 32 ] or injecting the peptide into the worm [ 33 ]. The use of synthetic peptides can be costly as pure peptide must be synthesized, often outsourced, for every neuropeptide experiment. Interestingly, feeding of exogenous peptides via E. coli has proven successful in manipulating C. elegans biological function [ 34 ]. However, this type of E. coli feeding of peptides has not been accomplished with endogenous neuropeptides. Here, we report an approach that enables the manipulation of neuropeptide activity by feeding neuropeptide macromolecules produced by bacteria, allowing for the simultaneous delivery of individual neuropeptides to large populations of animals. Our gain-of-function approach of feeding bacteria containing the neuropeptide macromolecules (mRNA and peptides) provides ease of application and cost-saving measures to deliver endogenous peptides to C. elegans. Neuropeptide rescue by feeding, outlined here, expands on RNA interference (RNAi) feeding paradigms, which have been successfully used to test gene function [ 35 , 36 ], wherein a plasmid encoding the RNA of interest is driven by isopropyl-β-D-thiogalactoside (IPTG)-induction. Whereas RNAi employs paired T7 promoters facing one another to produce double-stranded RNA, our protocol utilizes a single T7 promoter to generate mRNA encoding the peptide of interest. Once the neuropeptide vector is assembled and transformed into E. coli , delivery of the peptide simply requires feeding the worms. This method allows for temporal control of peptide delivery, animals can be fed at any life stage, and the number of animals treated is readily flexible. The paradigm rescues individual, processed neuropeptides, leveraging the genetic amenability of the C. elegans food source, Escherichia coli , to circumvent the need for transgenic development and enable high-throughput rescue and elucidation of individual neuropeptide function [ 37 ]. We demonstrate the application of this paradigm by rescuing behaviors driven by neuropeptides synthesized from pdf-1 , ins-6 , and ins-22 , and expand upon the previously established behaviors of flp-3 [ 38 ]. Materials and Methods C. elegans Strains C. elegans strains were maintained on nematode-growth media (NGM: 51 mM NaCl, 10 mM peptone, 51 mM agar, 1 mM CaCl 2 , 1 mM MgSO 4 , 25 mM KPO 4 (pH 6.0), 13 µM Cholesterol) plates seeded with E. coli OP50 at 15 – 20°C, according to standard procedures [ 39 ]. Strains used are listed in Table S1 . The strains selected from previous publications have validated the associated neuropeptide behavior. For pdf-1 associated assays, the strain UR954 ( pdf-1(tm1996) III; him-5(e1490) V) creates a pdf-1 loss of function (lof) behavior by a 588 base pair gene deletion resulting in a splice donor variant. The control strain for pdf-1 behaviors was CB4088 him-5(e1490) V, which creates a higher incidence of males by a point mutation (G to A) resulting in a splice acceptor variant. flp-3 lof behavior was tested by JSR99 ( flp-3(pk361) X; him-8(e1489) IV) whose flp-3 allele results in a 439 base pair deletion resulting in a suspected frame shift. The him-8 allele CB4088 ( him-8(e1489) IV) selected results in a higher incidence of males by a point mutation (G to A) resulting in a missense mutation. The Bristol wildtype isolate (N2) was used as the control for the INS behavior tests since they were based in hermaphrodite behavior. ins-6 lof behavior was tested by IV302 ( ins-6(tm2416) II; kyEx2595[ str-2 p::GCaMP2.2b + unc-122 p::GFP]), where the tm2416 allele results in a 316 base pair deletion that results in a splice donor variant. ins-22 lof behavior was tested by RB2594 ( ins-22(ok3616) III) which creates a ∼700 base pair gene deletion resulting in a putative frame shift. JSR188 was generated by mating UR954 and UR930 animals. UR930 ( pdfr-1(ok3425) III; him-5(e1490) V) results in pdfr-1 loss of function by a 605 base pair deletion resulting in a splice acceptor variant. The cross was monitored using validated primers from Wormbase.org ; pdf-1(tm1996) external left (CCGTGGAGGTACCAGGTTAA), pdf-1(tm1996) external right (TCAAGGTCTCGCCTCTAGGA), pdfr-1(ok3425) external left (CGTGGAATCATCGCTACCTT), and pdfr-1(ok3425) external right (TTTATGCAGGCTTATTGCCC). The final generated strain was confirmed by sequencing using the primers pdf-1(tm1996) internal left (CCATTCCGATGAGTCCGTTG) and pdfr-1(ok3425) internal left (TTTACTCCTTGACGGGAACG). To test the FLP-3 receptor FRPR-16 associated behavior, JSR152 ( flp-3(pk361) X; frpr-16(gk5305 [ lox p + myo-2 p::GFP:: unc-54 3’ UTR + rps-27 p::neoR:: unc-54 3’ UTR + lox p]II)) was used, creating a frpr-16 lof mutation by deleting 1685 base pairs, resulting in a splice acceptor variant. JSR166 was generated by mating IV302 and HC196 animals. HC196 ( sid-1(qt9) V) results in sid-1 loss of function single base pair mutation C to T resulting in the gain of a stop codon. The cross was monitored using primers external left (TCCTTCGCCTGGAATTAGAT), external right (AGCAAAATCCGTACATTCGC) and sequenced with an internal left primer (AAACTTCCGACGGTTTATCC). Neuropeptide Plasmid Design and Feeding Peptide Plasmid Design and Generation DNA sequences encoding individual peptides were identified via www.wormbase.org . The endogenous processing patterns of the peptides selected are mapped in ( Figure S1 ). Sequences were flanked with the endogenous cleavage sites for the EGL-3 processing enzyme, which cleaves dibasic resides. Sequences encoding MRFGKR and KRK-STOP codons were therefore placed prior to, and following the peptide codon sequences, respectively. This construct lacks the signal peptide sequence found in endogenous neuropeptides. Finally, Gateway Cloning sites attB1 and attB2 sites were attached to the ends of the sequences. These final sequences (comprised of attB1::MRFGKR::peptide::KRK-STOP::attB2) were ordered from Integrated DNA Technologies (IDT) using their DNA Oligo and Ultramer DNA Oligo services, depending on the size of the oligo ordered. Both forward and reverse sequences were ordered ( Table S2 ). Lyophilized oligos were prepared following IDT Annealing Oligonucleotides Protocol ( https://www.idtdna.com/pages/education/decoded/article/annealing-oligonucleotides ). In short, they were resuspended in Duplex Buffer (100 mM Potassium Acetate; 30 mM HEPES, pH 7.5; available from IDT), preheated to 94 °C to a final concentration of 40 μM. Complementary oligo sequences were then mixed in equimolar ratios and placed in a thermocycler at 94 °C for 2 minutes prior to a stepwise cooling to room temperature. Annealed oligos were used to perform a BP reaction with pDONR p1-2 donor vector to generate pENTRY clones (Gateway Cloning, ThermoFisher). Entry clones were then recombined with pDEST-527 (a gift from Dominic Esposito (Addgene plasmid # 11518)) in LR reactions generating expression clones. The control (SCRAMBLE) was generated in an identical manner, with the sequence between the cleavage sites being amplified from pL4440 (provided by Victor Ambros, University of Massachusetts Medical School, MA) to produce a peptide that lacks sequence homology to any known peptide ( Table S2 ). Purified neuropeptide expression vectors were stored at -20 °C or -80 °C for long-term storage. For the ins-22 experiments, the DNA coding sequence for the peptide was identified as described above, without the Gateway Cloning sites. These sequences were codon-optimized and cloned in pET-21a(+) cloning vector via XhoI/XhoI strategy by GenScript ( www.genscript.com ). The SCRAMBLE control sequence and plasmid were generated using the same cloning strategy by GenScript. Plasmids arrived lyophilized and were re-suspended in nuclease-free H 2 O to a concentration of 100 ng/μL and stored at -20 °C. The plasmid maps displayed in Figure S2a,b were rendered by SnapGene® software (from Dotmatics; available at snapgene.com ). Peptide Feeding Bacterial Preparation The neuropeptide expression vectors were transformed into competent DH5α cells (NEB® [New England Biolabs] 5-alpha Competent E. coli (High Efficiency) Cat# C2987I). Peptide-expressing cultures on LB agar plates (10 g/L NaCl, 10 g/L Tryptone, 5 g/L Yeast Extract, 5 g/L Agar) containing 100 µg/mL ampicillin (AMP), were stored at 4 °C for up to 2 months. From this plate, single colonies were selected for growth in 5 mL of LB media (10 g/L NaCl, 10 g/L Tryptone, 5 g/L Yeast Extract) containing ampicillin at 37 °C for 16 hours. The optical density of the grown cultures (OD 600 ) was adjusted to 1.0. 75 μL of 1.0 OD 600 peptide-expressing culture was plated onto 60 mm NGM agar plates containing 100 μg/mL AMP and 1 mM isopropyl-β-D-thiogalactoside (IPTG) at room temperature for at least 8 hours prior to use, for no longer than 1 week. Competent iOP50 ( E. coli , rnc14::(delta)Tn10, lacz(gamma)A::T7pol camFRT) obtained from Caenorhabditis Genetics Center was created using previously described methods [ 40 ]. Briefly, iOP50 stocks were streaked out onto plates containing 50 µg/mL tetracycline and LB and grown at 37°C overnight. Then, single colonies of iOP50 were isolated and used to inoculate 2.0 mL LB containing 50 µg/mL tetracycline and placed in a 37°C shaker overnight. 0.5 mL of each culture was used to inoculate 3.0 mL of LB medium without antibiotics and was grown for 2 hours at 37°C in a shaker. Each culture was then aliquoted in 0.75 mL increments into four 1.5 mL tubes and cooled on ice for 10 minutes. Next, the cells were harvested by centrifugation at 6,000 rpm for 5 minutes at 4°C. The resulting supernatant was discarded, and the cells were placed back on ice and resuspended in 1.0 mL 100 mM ice-cold CaCl 2 solution. Cells were kept on ice for 20 minutes and then harvested by centrifugation as in the previous step. After discarding the supernatant, the cells were resuspended in 150 µL of ice-cold CaCl 2 solution and placed on ice for immediate use in transformation. Expression clones were transformed into competent iOP50 cultures using the New England Biolabs protocol (C2987H/C2987I). Single colonies of transformed cells were isolated and cultured overnight in 3.0 mL of LB medium containing 50 µg/mL tetracycline (TET) and 17 µg/mL chloramphenicol (CAM) at 37°C in a shaker. Cultures were frozen down as glycerol stocks and stored at -80°C. Successful transformation was verified by isolating plasmids from cultures using a Zyppy Plasmid Miniprep Kit (Zymo Research #D4019) and sending samples for whole-plasmid sequencing. For plating the bacteria containing PDF-1 and FLP-3 , LB medium containing 50 µg/mL ampicillin (AMP), 50 µg/mL tetracycline (TET), and 17 µg/mL chloramphenicol (CAM) was inoculated with iOP50 expressing either the peptide of interest or the control peptide and cultured for 16-20 hours at 37°C in a shaker. 75 µL of bacteria expressing the peptide was plated onto 60 mm NGM plates containing 50 µg/mL AMP, 50 µg/mL TET, and 17 µg/mL CAM, and 1 mM IPTG. For all peptides, seeded plates were left to dry at least 8 hours at room temperature before plating worms and were used no longer than 1 week after plating. For In-22, LB containing 50 µg/mL tetracycline and 50 µg/mL carbenicillin was inoculated with iOP50 expressing either the peptide of interest or the control peptide and cultured for 18-20 hours at 37°C in a shaker. 100 mm NGM plates containing 50 µg/mL tetracycline, 50 µg/mL carbenicillin, and 1 mM IPTG were plated with 1.0 mL of the corresponding culture. Seeded plates were left to dry for at least 24 hours at room temperature and were never stored for longer than 72 hours before use. Approximately one hour before transferring worms to peptide or control plates (SCRAMBLE), 200 µL of 0.1 M IPTG was added to each plate and left to dry. Peptide Feeding of Bacterial Cells or Supernatant Alone To test if the bacterial cells expressing the peptide construct or the supernatant that the cells were grown in was sufficient to restore neuropeptide-associated behavior, the cells expressing the peptide were separated from the media in which they grew and might have expressed macromolecules into. 5 mL of LB medium containing 100 µg/mL ampicillin (AMP) with DH5α cells expressing the control SCRAMBLE construct or FLP-3-9 was grown for 16 hours at 37 °C with shaking. At the same time, 5 mL of LB containing OP50 E. coli that did not express the peptide was grown for 16 hours at 37 °C with shaking. Afterwards, the cultures were centrifuged at 3900 RPM (rotations per minute) or 11,000 x G for 5 minutes at 4 °C to separate the cells from the media. The supernatant from the DH5α E. coli cells expressing the peptide was mixed with the OP50 cells not expressing the peptide, and the DH5α E. coli cells expressing the peptide were mixed with the OP50 cell supernatant. The cultures were adjusted to have an OD 600 = 1.0. 75 μL of each culture (SCRAMBLE DH5α cells, SCRAMBLE DH5α supernatant, FLP-3-9 DH5α cells, and FLP-3-9 DH5α supernatant) was plated onto 60 mm NGM agar plates containing 100 μg/mL AMP and 1 mM IPTG. The plates were stored at room temperature, 20-22 °C, for at least 8 hours prior to use, for no longer than 1 week. Peptide Feeding All animals were maintained on bacterial lawns of OP50 E. coli , at 20 °C, on NGM agar plates until the start of experiments. Mutant or control animals were transferred onto lawns of DH5α or iOP50 E. coli . Animals were reared on the peptide-expressing lawns for at least 48 hours at 20 °C before assaying for rescue of mutant phenotype at the appropriate developmental stage. See each section of the behavioral assay methods for the exact peptide feeding parameters. Behavioral Assays Excursion Assay (pdf-1) The mate searching behavior of pdf-1 mutants in a him-5 background was quantified in a food leaving assay. him-5 animals were used as wildtype control to ensure the presence of males. him-5 and pdf-1 animals were fed bacteria expressing no peptide (OP50), control peptide (SCRAMBLE), PDF-1A peptide, PDF-1B peptide, or 1:1 PDF-1A and PDF-1B peptide (by mixing bacterial cultures expressing these peptides). Four to six larval L4 hermaphrodites were passed onto peptide-containing plates. These worms were grown at 20 °C for approximately 4 days, until the male progeny of the initial L4 worms had developed into young adults. The day prior to the assay, young adult male pdf-1 or him-5 worms were singled onto 60 mm plates containing lawns of either OP50 or appropriate peptide cultures. To determine the mate searching effects of pdf-1 , we performed a food-leaving assay as described previously [ 41 – 43 ], with modifications. In this assay, individuals were placed on a small food spot, and track patterns were scored at the indicated times. Assay plates were prepared one day prior to assaying on 100 mm plates with 10 mL of Leaving Assay media (25 mM KPO 4 (pH 6.0), 1 mM MgSO 4 , 1 mM CaCl 2 , 50 mM NaCl, 2.5 g/L Peptone, 17 g/L Agar). On center of plate, 7 µL of OP50 was added. In assays using iOP50 assay plates, 7 µL of iOP50 containing the appropriate peptide (ex. SCRAMBLE iOP50 assay plates made for animals fed SCRAMBLE iOP50) was added. Plates were lightly covered and stored at room temperature overnight (∼20⁰C, < 40% humidity). On the day of the assay, a single male was plated on the assay plate and placed in a dark, 20°C incubator. At 2, 6, and 24 hours after the worms are plated, plates were scored for male worm tracks. Tracks were scored based on their distance from the center of the plate [ 41 ]. “Never left food” indicates the absence of tracks outside the food spot. “Minor excursion” indicates that the tracks never extended beyond 10 mm from the food. “Major excursion” indicates the presence of tracks past the 10 mm boundary. We quantified the food leaving behavior at three different time points (2, 6, and 24 hours) [ 42 ]. We additionally quantified the mate searching defect of pdf-1 as a Probability of Leaving per hour (P L /hr) [ 43 ]. In this method, we reduce the analysis of the leaving behavior to a single value, by scoring the worms leaving the food lawn as Leavers (traveling beyond 35 mm from the food source) or Non-Leavers (did not travel further than 35 mm from center of food). Worm in the > 35 mm from the center of food bin were scored as “Leavers” [ 43 ]. The probability of leaving per hour (Probability of Leaving (P L )) was calculated using an R script developed in [ 42 ], first cited in [ 43 ], with assistance by (Personal Communications to Barrios, 2020). P L was calculated by the “hazard obtained by fitting an exponential parametric survival model to the censored data using maximum likelihood” [ 43 ]. Avoidance Assay (flp-3) Avoidance drop assays were performed as described previously [ 38 , 44 ]. This was performed on him-8 or flp-3;him-8 loss of function male animals. Fifty to sixty L4 male worms were picked by sex to isolate the males and stored at 20 °C for at least 5 hours to overnight to be assayed as young adults. One to four hours prior to the assay, the lids of unseeded plates were tilted to allow any excess moisture to evaporate off the plates. At the time of the assay, 10 or more males were transferred onto each of the dried, unseeded NGM plates. A drop of either water or 1 µM ascr#8 (a nonvolatile C. elegans mating pheromone) was placed on the tail of forward moving animals, and their response was scored as either an avoidance response, or no response. The avoidance index was calculated as: Chemotaxis Assay (ins-6) A salt chemotaxis assay was performed as previously described in [ 45 ],[ 46 ], to test the functionality of ins-6 after rescue-by-feeding. Wildtype (N2 Bristol) and ins-6 loss of function worms were fed either a control peptide (SCRAMBLE) or INS-6 peptide. This was done throughout the animals’ lives by passing 4-6 L4 larval onto an NGM plate containing 100 μg/μL AMP and 1 mM IPTG with 75 µL of peptide OD 600 = 1.0. These worms were grown at 20 °C for about 4 days until the progeny of the initial L4 worms were young adults. Chemotaxis plates were prepared the day prior to testing, by adding 10 mL of agar (5 mM KPO 4 (pH 6.0), 1 µM MgSO 4 , 1 µM CaCl 2 , 20 g/L agar, and 8 g/L Difco Nutrient Broth) to 100 mm petri dishes. To prepare the “high salt” plates, 750 mM NaCl was added prior to plate pouring. The high salt plate were stored at 4°C for up to one month, while the Chemotaxis Plates were made one day prior to testing. To create the high and low salt plugs, the back end of a Pasteur pipette was used to punch a 5 mm plug out of each plate. These 2 plugs were placed on opposite edges of the plate. A 10 mm radius was be drawn around the location of the plugs. Plates were stored, lightly covered, overnight at room temperature (∼20°C, < 40% humidity). On the day of the assay, young adult worms, either control worms fed OP50 E. coli or peptide-fed worms, were washed off peptide plates with M9. Worms were allowed to settle by gravity for 4 minutes before removing the supernatant, washing the worms. Worms were then washed with Chemotaxis Buffer (5 mM KPO 4 (pH 6.0), 1 mM MgSO 4 , 1 mM CaCl 2 ) three times. To prepare the Chemotaxis plates for the assay, high and low salt plugs were removed with forceps, and 1 µL of 0.5 M sodium azide (NaN 3 ) was added to the plage where the plugs had rested. Approximately 30 µL of worms in Chemotaxis Buffer were spotted onto the edge of the agar, between the location of the high and low salt gradient. Worms were left to chemotax for 1 hour before scoring the number of worms within the 10 mm radii of high and low salt areas using the below choice index to assess the behavior of animals that had made a choice between the two salt location: Olfactory Chemotaxis Assay (ins-22) Chemotaxis assays were performed using worms that were transferred at the L4 stage to plates seeded with iOP50 containing a plasmid expressing either a control sequence (SCRAMBLE) or the peptide of interest (INS-22). These experiments were performed on wildtype (N2 Bristol) animals or ins-22 loss of function animals. After 48 hours of exposure, we tested the naïve chemosensory preference of Day 2 Adults using a protocol based on previously published assays [ 44 ]. Briefly, assays were performed on unseeded 100mm NGMs. On the back of each plate, two marks were made on opposite sides of the plate, approximately 5mm from the edge. 1 μL of sodium azide (Thermo Fisher) was placed on both spots and allowed to dry before adding 1 μL of 0.1% or 10% butanone (Sigma Aldrich) diluted in ethanol on one mark and ethanol on the other. Using M9 buffer, worms were washed off their plates and subsequently washed three times to eliminate any leftover bacteria that could impact baseline behavior. Then, worms were placed near the bottom center of the plate, equidistant between the two marks, and allowed to chemotax for an hour. Chemotaxis indices were calculated as follows: Statistical Analysis Power Analysis Prior to the study, a post-hoc power analysis (ClinCalc LLC., Chicago, IL, USA) was performed using preliminary data from OP50 E. coli fed worms to determine the number of samples required to establish a difference between the wildtype controls and the neuropeptide loss of function mutants. This was performed using a 0.05 alpha rate. For the excursion assay comparing pdf-1 lof animals in a him-5 background compared to him-5 males, a dichotomous power analysis was used to compare non-leavers ( 35 mm). n = 39 (where n = 1 is one male on one assay plate) was required for 100% powered experiment and 13 for power > 80%. A sample size of n = 50 samples per genotype and feeding condition was selected. For avoidance behavior towards ascr#8 comparing wildtype control him-8 animals to flp-3 lof males in a him-8 background, n = 3 samples (n = 1 is one plate of ten worms) was appropriate to have a 100% powered test, using a continuous power test. A sample size of N = 10 was selected. Points plotted on graphs represent n = 1. For the salt chemotaxis assay with ins-6 lof animals, n = 4 samples (n = 1 is one plate of 100-200 worms) were required for power > 80% and 13 for 100% power. A sample size of n = 10 was selected. Points plotted on graphs represent n = 1. For chemotaxis behavior of ins-22 animals, the behavior of SCRAMBLE fed iOP50 animals towards 10% butanone was used to determine that 20 samples (n = 1 is one plate of 100-200 worms) were required for 97.5% power and 11 samples were required for power > 80%. A sample size of n > 15 was selected. Points plotted on graphs represent n = 1. Reproducibility In all experiments, the investigators were blinded to genotype. Young adult animals were tested in all behavioral assays. For the behavioral tests of flp-3 and ins-6 , the assay was repeated over at least 3 days, with no more than 3 replicates in a day, until at least 10 plates had been tested. For ins-22 , the assays included testing 5 plates per day, for a total of three biological replicates (n = 15). For pdf-1, t he assay was performed across at least two days per condition, with at least n = 50, wherein each assay plate with one male is equal to n = 1. When possible, the results of an individual n are displayed on the graphs. Statistical Comparison Statistical analysis was performed in GraphPad Prism (version 10.4.1). Prior to any statistical comparison, the normality and frequency distribution were assessed for each of the groups. If these tests showed normal distributions, a Student’s unpaired two-tailed t-test followed by Bonferroni’s correction was applied; this was used for ins-6 and ins-22 results. If the data was non-parametric, as was often the case with the flp-3 data, a Mann-Whitney test was performed followed by Bonferroni’s correction. For the pdf-1 tests where animals were fed different types of peptides, a One-way ANOVA with Dunnett’s post-hoc test was used to compare within genotype results. For all graphs, the average was plotted with the standard error of the mean (SEM). Results and Discussion Bacterial Delivery of Neuropeptide Vectors Rescues Behavior in Loss of Function Mutants To demonstrate the efficacy of the neuropeptide delivery by bacterial feeding, we tested the behavior of loss of function ( lof ) animals from each of the three neuropeptide classes in C. elegans . Each of these behavioral assays was paired with the appropriate wildtype control. For male animal behavior, him-5 or him-8 lines were used to produce a higher incidence of males (him) than the wildtype population of 0.1% males [ 47 , 48 ]. The choice of which him mutant to use depended on the genetic position of neuropeptide gene being tested and other the position of other genes of interest used in the initial studies establishing the associated neuropeptide behavior. Male Excursion Behavior (pdf-1) Wildtype males display a characteristic exploratory behavior when left on a lawn of food, as well-fed males leave food in search of mates [ 42 , 43 ]. The pigment dispersing factor PDF-1 (also known as NLP-74) neuropeptide plays a significant role in male mate-searching behavior, regulating neural circuits that control the choice between two predominant male interests, finding food and finding mates [ 42 , 49 ]. The pdf-1 precursor encodes two neuropeptides: PDF-1A (SNAELINGLIGMDLGKLSAVG-N terminus) and PDF-1B (SNAELINGLLSMNLNKLSGAG-N terminus) [ 50 , 51 ]. The males used in this behavior were generated by a him-5 lof background mutation. pdf-1 lof males did not leave food as readily as wildtype worms, suggesting that these worms do not display exploratory behavior, as previously described ( Figure S2a,b ) [ 42 ]. When fed either DH5α E. coli expressing individual PDF-1 peptide (or a 1:1 combination of both), pdf-1 lof had a higher P L compared to SCRAMBLE fed pdf-1 lof males ( Figure 1a , S2c ). However, PDF-1B and a 1:1 ratio of both peptides resulted in a significantly different P L from pdf-1 males fed PDF-1A alone. While the P L of peptide-fed males were significantly higher than pdf-1 lof males fed SCRAMBLE, they were still significantly lower than wildtype males fed SCRAMBLE ( Figure 1a ). Download figure Open in new tab Figure 1: Behavioral of neuropeptide associated behavior in loss of function mutant background A) pdf-1;him-5 lof mutant males fed a SCRAMBLE peptide have a significantly lower probability of leaving food when compared to wildtype control him-5 males ( #### p ≤ 0.0001, unpaired t-test). When fed any of the pdf-1 produced peptides in a DH5α E. coli vehicle, the probability of leaving is significantly higher than the SCRAMBLE fed pdf-1 males (****p ≤ 0.0001, One-way ANOVA with Dunnett’s post-hoc test). B) When exposed to a water solvent control (ascr#8 -), both him-8 and flp-3 males act the same. When exposed to ascr#8 (ascr#8 +), wildtype him-8 males do not avoid the cue while flp-3;him-8 lof males do. When fed FLP-3-9 peptide in a DH5α E. coli vehicle, the avoidance towards ascr#8 by flp-3 lof males is significantly decreased (****p ≤ 0.0001, Mann-Whitney test with Bonferroni correction, new p-value ****p ≤ 0.00005). C) Wildtype N2 animals are more attracted to high 750 mM NaCl than ins-6 lof animals. When fed INS-6 in a DH5α E. coli vehicle, the attraction of ins-6 lof animals to NaCl is significantly increased (*p ≤ 0.05, ***p ≤ 0.001, unpaired t-test with Bonferroni correction, new p-value *p ≤ 0.025, ***p ≤ 0.0005). Pheromone Avoidance (flp-3) C. elegans produce and release pheromones as a means of chemical communication to signal a variety of features to other animals, such as food or mate presence [ 52 ]. One such pheromone is ascaroside #8 (ascr#8) [ 53 ]. We have previously worked to characterize the behavior of animals towards this hermaphrodite produced pheromone and have found that wildtype hermaphrodites avoid ascr#8 while males are attracted to it [ 38 ]. We have further identified that males deficient in the neuropeptide gene flp-3 lose their attraction towards ascr#8 and start to avoid the cue ( Figure S2d ) [ 38 ]. The males of this behavior were created in a him-8 lof background. The flp-3 neuropeptide precursor creates 10 different neuropeptides, yet only 2 are involved in the male behavior towards ascr#8 [ 38 ]. Both the second and the ninth peptide (FLP-3-2 and FLP-3-9) produced by flp-3 are involved with suppressing the basal avoidance behavior seen in flp-3 lof males, yet only FLP-3-9 is necessary for restoring the attraction towards ascr#8 [ 38 , 54 ]. When we fed male flp-3 lof animals DH5α E. coli expressing FLP-3-9 (NPENDTPFGTMRFG-N terminus), we saw a significant suppression of avoidance behavior towards ascr#8 ( Figure 1b ). Salt Chemotaxis (ins-6) Insulin and insulin-like peptides serve signaling functions in Drosophila and C. elegans homologous to the human insulin-like growth factor (IGF), which regulates FOXO activity [ 55 ]. In C. elegans, ins-6 encodes only one processed INS-6 peptide (VPAPGETRACGRKLISLVMAVCGDLCNPQEGKDIATECCGNQCSDDYIRSACCP-N terminus) [ 56 , 57 ], though the gene was originally postulated to encode two putative proteins [ 1 , 23 ]. The formation of a single longer peptide is common in the insulin-like class of peptides [ 58 ]. ins-6 functions in dauer formation [ 56 , 58 ] and sensory modulation of large fluctuations in salt concentration, with loss of ins-6 causing dysfunction of NaCl attraction [ 59 ]. While wildtype hermaphrodite worms were attracted to high concentrations of salt (750 mM), there was a significant decrease in attraction in ins-6 mutant animals ( Figure S2e ) [ 59 ]. Wildtype and ins-6 lof animals fed SCRAMBLE peptide also had significantly different levels of salt chemotaxis ( Figure 1c ). Feeding of DH5α E. coli expressing INS-6 peptide to ins-6 lof animals resulted in an in attraction to high salt concentration ( Figure 1c ). Supernatant from Bacteria Expressing Peptide May Be Sufficient for Behavioral Rescue We tested whether the cells or the supernatant from a grown liquid culture expressing the neuropeptide construct was sufficient for behavioral restoration ( Figure S3 ). We selected the flp-3 associated avoidance behavior of ascr#8 to screen the different culturing conditions. We found that while the behavior of him-5 males fed any combination of the initial culture of DH5α cells or supernatant expressing a peptide construct (SCRAMBLE or FLP-3-9) did not alter their lack of avoidance towards ascr#8. However, flp-3;him-5 lof males did exhibit reduced avoidance to ascr#8 when they were fed a combination of the supernatant of DH5α cells expressing the FLP-3-9 peptide with OP50 cells that did not express any peptide. These results suggest that the peptide macromolecule of interest that restores the neuropeptide associated behavior is excreted from the bacterial cells during the initial growth of the culture. This also supports that the cells do not need to be induced with IPTG (which is only present in the plates and not the liquid cultures) to express this macromolecule. This lack of induction requirement might not entirely be surprising. Other researchers using E. coli as a vehicle for expressing a designed construct have found it to have leaky expression prior to induction, whether by IPTG or another induction agent [ 60 , 61 ]. These studies found that while the amount of dsRNA or enzyme produced did increase after induction, the uninduced state was sufficient for the creation of these macromolecules. This would mean that the bacterial cells are able to create the expression vector macromolecules regardless of the addition of IPTG. Different E. coli food sources lead to Neuropeptide Behavior Rescue While the previous experiments in this study have used DH5α E. coli expressing peptides to shape neuropeptide related behaviors, there are cases when using different E. coli strains may be desirable. Given the differences in nutrient composition of the different E. coli strains and worms preferring more nutritious bacteria [ 62 ], expressing peptides in HB101 or HB115 strains offers viable alternatives. To most closely compare to other laboratory studies, the ability to use the widely used uracil deficient OP50 E. coli strain as the neuropeptide delivery system is desirable [ 39 ]. Recently an IPTG inducible strain of OP50 has been created, iOP50, which can be cultured to create chemically competent cells [ 40 ]. All constructs presented in this section were transformed into iOP50 before being fed to the C. elegans . For testing male pdf-1 associated leaving behavior, we first fed the animals on iOP50 peptide plates before transferring them to a leaving assay plate that is seeded with OP50 containing no peptide. Under these conditions, male pdf-1 lof animals fed PDF-1 peptides from iOP50 left food at a higher rate than pdf-1 lof animals fed a SCRAMBLE peptide from iOP50 ( Figure 2a ). However, the extent of food leaving by males after being fed iOP50 with peptide was lower than observed when animals were fed DH5α E. coli ( Figure 1a ). This may be because animals are tested over the course of 24 hours and the level of peptide in their bodies may decrease over time. To address this, we tested animals fed iOP50 with peptide and then transferred them to iOP50 assay plates seeded with the same peptide they were previously fed ( Figure 2b ). By doing this, the trend of pdf-1 lof animals fed PDF-1 leaving food at a higher rate continued, and the overall rates of leaving food also increased ( Figure 2b ). Download figure Open in new tab Figure 2: Neuropeptide rescue by feeding can be accomplished in different E. coli vehicles A) him-5 males fed a SCRAMBLE peptide in iOP50 E. coli leave food at a higher rate than pdf-1;him-5 lof males ( #### p ≤ 0.0001, unpaired t-test). pdf-1;him-5 m ales fed PDF-1 peptides in iOP50 and then plated on an assay plate containing OP50 E. coli without peptide, do leave food at a higher rate than pdf-1 SCRAMBLE iOP50 E. coli fed animals (****p ≤ 0.0001, One-way ANOVA with Dunnett’s post-hoc test). B) him-5 males fed SCRAMBLE peptide in iOP50 E. coli and then placed on an assay plate seeded with SCRAMBLE peptide in iOP50 E. coli leave food at a higher rate than pdf-1;him-5 lof males ( #### p ≤ 0.0001, unpaired t-test). pdf-1;him-5 males fed PDF-1 peptides in iOP50 and then plated on an assay plate containing iOP50 E. coli expressing the corresponding peptide, leave food at a higher rate than pdf-1;him-5 lof animals fed SCRAMBLE iOP50 E. coli and at a higher rate than animals on assay plates without peptide (****p ≤ 0.0001, One-way ANOVA with Dunnett’s post-hoc test). C) When exposed to a water solvent control (ascr#8 -), both him-8 and flp-3;him-8 males act the same. When exposed to ascr#8 (ascr#8 +), wildtype him-8 males do not avoid the cue while flp-3 lof males do. When fed FLP-3-9 peptide in iOP50 E. coli , the avoidance towards ascr#8 by flp-3 lof males is significantly decreased (****p ≤ 0.0001, Mann-Whitney test with Bonferroni correction, new p-value ****p ≤ 0.00005). D) Animals deficient in ins-22 show significantly stronger chemotaxis towards 10% butanone than ins-22 lof animals fed INS-22. The ins-22 lof animals fed INS-22 have a chemotaxis index no different than wildtype animals ( ns p ≥ 0.05, ***p ≤ 0.001, unpaired t-test wildtype SCRAMBLE to INS-22, Mann-Whitney test comparisons to ins-22 fed SCRAMBLE with Bonferroni correction (new p-value ns p ≥ 0.025, ****p ≤ 0.00005). flp-3 lof males exposed to ascr#8 after being fed FLP-3-9 in iOP50 lacked avoidance to the cue while males fed the SCRAMBLE peptide continued to avoid it ( Figure 2c ). These results matched the observed behavior of animals fed FLP-3-9 in DH5α E. coli ( Figure 1b ). For flp-3 , males are transferred directly from iOP50 peptide plate onto an unseeded NGM assay plate for no more than 30 minutes during the testing. Due to this, it was not necessary to reapply the iOP50 peptide during testing. We also tested the delivery of peptide using a different neuropeptide expression vector. To test the behavior associated with INS-22, a new backbone vector of pET-21 was procured to circumvent the use of Gateway Cloning and the pDest-527 vector ( Figure S4a ). In this new neuropeptide expression vector, the peptide endogenous peptide sequence flanked by the peptide cut sites was ordered as a complete plasmid in a pET-21 vector ( Figure S2b ). This vector was used to test the behavior of INS-22 (MHTTTILICFFIFLVQVSTMDAHTDKYVRTLCGKTAIRNIANLCPPKPEMKGICSTGEYP SITEYCSM-N terminus). Unlike INS-6, INS-22 antagonizes the DAF-2 neuropeptide receptor [ 63 , 64 ]. We discovered that animals lacking ins-22 exhibit increased naive chemotaxis towards a neutral concentration of 10% butanone compared to wildtype animals ( Figure S4c ). This behavior persists in animals fed the SCRAMBLE peptide in iOP50 E. coli ( Figure 2d ). When fed the INS-22 peptide, the ins-22 lof animals displayed naive chemotaxis similar to wildtype animals, indicating that peptide feeding rescued normal naive chemotaxis towards 10% butanone ( Figure 2d ). Neuropeptide Rescue by Feeding Requires the Cognate Neuropeptide Receptor To ensure that the observed behavior is resulting from the neuropeptide being fed to the animal, activating the neuropeptide receptor, we tested the behavior of animals deficient in the neuropeptide receptor. Pairing neuropeptides ligands to their cognate receptors is an ongoing effort in peptidomic research. Recent efforts have uncovered many of the individual neuropeptide pairings and the range over which these connections functions [ 26 , 65 , 66 ]. For the current study, we were interested in studying the function of receptors that have one peptide ligand. This would eliminate the class of insulin-like peptides which bind to DAF-2 from this current study [ 23 , 63 ]. PDF-1 peptides binds primarily to one neuropeptide receptor PDFR-1 [ 42 , 67 ]. Though PDFR-1 also binds to peptides produced by pdf-2 (also known as nlp-37 ), these ligands are not involved in behavior of males leaving food to search for mates [ 42 , 66 ]. pdfr-1 lof mutants in a him-5 background do not leave food to search for mates ( Figure S5a,b ), even when fed excess peptide ( Figure 3a , S5c ). The double mutant males of the pdfr-1 and pdf-1 neuropeptide, partially left food to search for mates when fed PDF-1A but not when fed the other peptides ( Figure 3a ). Though PDF-1A was able to promote the male leaving behavior, we do not believe this was to a biologically significant level since the rates of leaving food were lower than the rate than pdf-1 lof males left food. This probability of leaving food of pdf-1;pdfr-1 males was not to the rate of pdf-1 males leaving food when fed a SCRAMBLE peptide ( Figure 3a ). The absence of food leaving to search for mates, even when receptor mutants are fed the neuropeptide, suggests that there are no off-target effects of the neuropeptide impacting other receptors. Download figure Open in new tab Figure 3: Neuropeptide receptor required for neuropeptide feeding A) pdfr-1;him-5 lof animals do not leave food more than 35mm, even if fed PDF-1 peptides in DH5α E. coli . Double mutants of pdf-1;pdfr-1 in a him-5 background also did not leave food at the rate of pdf-1 animals fed SCRAMBLE, though pdf-1;pdfr-1;him-5 animals fed PDF-1A DH5α E. coli do have a higher incidence of leaving food than SCRAMBLE fed animals ( ns p ≥ 0.05, ****p ≤ 0.0001, One-way ANOVA within genotypes with Dunnett’s post hoc test). B) Double mutant flp-3;frpr-16 males in a him-8 background fed bacteria expressing FLP-3-9 avoid ascr#8 to the same level as SCRAMBLE DH5α E. coli fed animals ( ns p ≥ 0.05, Mann-Whitney test with Bonferroni correction, new p-value ns p ≥ 0.025). The flp-3 neuropeptide gene makes 10 different peptides that bind to 4 different receptors [ 38 , 66 ]. Neuropeptide receptors DMSR-1-2 and DMSR-7-1 bind to many of the flp class of neuropeptides including flp-3 , while FRPR-16-1 binds flp-3 and nlp-23 peptides and NPR-10-1 binds flp-3 and nlp-23 peptides [ 66 ]. We have previously identified that the receptors FRPR-16 and NPR-10 are involved in the flp-3 male behavior towards ascr#8 [ 38 ]. The FLP-3-9 neuropeptide binds activates the FRPR-16 receptor at lower concentrations than the NPR-10 receptor [ 38 ], so we elected this as our neuropeptide receptor candidate for FLP-3-9. We have previously demonstrated that without FRPR-16 males will avoid ascr#8 [ 38 ]. When we generated a double mutant of flp-3;fprpr-16 we observed avoidance of ascr#8 in animals fed OP50 E. coli without peptide ( Figure S5a ). When fed FLP-3-9 peptide in DH5α E. coli , the avoidance behavior is sustained ( Figure 3b ). These data shows that while FLP-3-9 binds to multiple receptors, FRPR-16 loss of function is sufficient to alter male behavior towards ascr#8. Behavioral Impacts of Neuropeptide Overexpression Depend on the Peptide Identity One question that arises with this feeding method is, how much neuropeptide makes its way into the worms and what would happen if there were an overexpression of neuropeptide? Quantifying the amount of neuropeptide produced endogenously is a difficult open question in the peptidomics field. One indication of how much of a particular neuropeptide is required is by looking at the neuropeptide precursor gene. Some neuropeptides are encoded multiple times in the same gene, like flp-6 encoding KSAYMRFG-N terminus six times [ 68 ]. One method used to detect the presence of neuropeptides is liquid chromatography mass spectrometry (LC-MS) [ 19 , 69 – 71 ]. While this method is extremely precise for detecting known and novel neuropeptides, it lacks the ability to quantify the amount of each neuropeptide present in vivo (personal communication with Sven Van Bael and Lisabet Timmermann, KU Leuven). One way to test the effects of what is likely an overexpression of neuropeptide is by feeding the neuropeptide-containing DH5α bacteria to wildtype animals. We tested the appropriate wildtype controls for each previously assessed behavior. We observed an increase in the leaving behavior of him-5 male worms fed PDF-1B and a decrease when fed PDF-1A in DH5α E. coli ( Figure 4a , S6a ). This behavioral difference disappears when both peptides are fed in combination ( Figure 4a ). These data suggest that different PDF-1 peptides play varying roles in mating behavior. Next, we examined the effects of this behavior using the iOP50 E. coli delivery. When males were fed an excess of iOP50 peptide and subsequently placed on an iOP50 assay plate, their rates of leaving food ( Figure 4b , S6b ) did not increase. Wildtype animals fed PDF-1 peptides produced by iOP50 also did not show an increased leaving rate of food when tested on an OP50-containing assay plate ( Figure S6c,d ). In fact in both scenarios, the rates of leaving food decrease. This suggests that there may be a precise balance of neuropeptide required for proper behavioral tuning. Download figure Open in new tab Figure 4: Behaviors resulting from overexpression of neuropeptides depend on the neuropeptide A) him-5 males fed PDF-1A in DH5α E. coli had a significant decrease in their probability of leaving food rate compared to animals fed SCRAMBLE peptide. PDF-1B him-5 animals had a significant increase in P L /hr when compared to SCRAMBLE fed animals. When PDF-1A and -1B were fed to animals in equal combination, their probability of leaving food was no different from SCRAMBLE fed animals (****p ≤ 0.0001, One-way ANOVA with Dunnett’s post-hoc test). B) him-5 males fed PDF-1 peptides in iOP50 E. coli and then tested on iOP50 assay plates containing a corresponding peptide, do not have excursions leaving food more than 35 mm at higher rates than SCRAMBLE fed males (**p ≤ 0.01,****p ≤ 0.0001, One-way ANOVA with Dunnett’s post-hoc test). C) him-8 males exposed to ascr#8 had no difference in their avoidance behavior whether they were fed bacteria expressing SCRAMBLE or FLP-3-9 in DH5α E. coli ( ns p ≥ 0.05, Mann-Whitney test). D) him-8 males fed SCRAMBLE or FLP-3-9 in iOP50 E. coli avoid ascr#8 at the same rate and behave the same towards the water solvent control as the previous studies ( ns p ≥ 0.05, Mann-Whitney test). E) Wildtype hermaphrodites fed SCRAMBLE or INS-6 peptide in DH5α E. coli displayed the same attraction towards high 750 mm NaCl ( ns p ≥ 0.05, unpaired t-test test). F) Wildtype hermaphrodites fed INS-22 peptide in iOP50 E. coli displayed slightly less attraction towards 10% butanone than animals fed SCRAMBLE (*p ≤ 0.05, unpaired t-test). G) Wildtype hermaphrodites fed INS-22 peptide in iOP50 E. coli were not as attracted to 0.1% butanone compared to animals fed SCRAMBLE (****p ≤ 0.0001, unpaired t-test). When him-8 male animals were fed FLP-3-9, their lack of ascr#8 avoidance was not changed compared to animals fed SCRAMBLE ( Figure 4c ). Together these data indicate that there are no obvious behavioral deficits across all neuropeptides being delivered in excess. Wildtype males fed FLP-3-9 iOP50 E. coli continued their non-avoidance of ascr#8 ( Figure 4d ). We then tested different insulin ligands for their overexpression phenotypes. When wildtype N2 animals was fed INS-6 in DH5α E. coli , there was no difference in the choice index of high salt taxis ( Figure 4e ). These data suggest that INS-6 overexpression by microbial feeding does not impact the behavior of animals towards high NaCl. There has been evidence that overexpression of some insulin like peptides may impact other behaviors like dauer formation [ 55 ]. When wildtype animals were fed an excess of INS-22 iOP50 E. coli , their behavior towards 10% butanone was decreased compared to animals fed SCRAMBLE ( Figure 4f ). When exposed to a highly attractive concentration of 0.1% butanone, wildtype animals fed INS-22 in iOP50 E. coli significantly reduced their attraction towards the cue ( Figure 4g ). While differences in behavior towards varying concentrations of butanone have been previously established [ 72 , 73 ], the impact of INS-22 on these behaviors has not been implicated in detail. Differences between the overexpression effects of the ins peptides may be due to the different interactions with the DAF-2 receptor, INS-6 is a strong agonist and INS-22 is an antagonist [ 63 , 64 ]. Neuropeptide Feeding Does Not Utilize RNAi-based Mechanisms Our method of neuropeptide study is most similar to RNA interference approaches, leading us to hypothesize that the microbes could be delivering RNA to the C. elegans . RNAi functions to knock down a gene by delivering dsRNA that interferes with the endogenous mRNA of that gene [ 74 – 76 ]. RNAi was first performed in C. elegans [ 75 , 76 ] and has since been accomplished by feeding, soaking, and injecting dsRNA [ 77 ]. The RNAi vector contains two T7 promoters going in opposite directions to create dsRNA [ 74 , 78 ], while our vector contains only 1, indicating that single stranded RNA (ssRNA) should be produced. The RNAi vector is then contained in an E. coli strain that has been modified to make more dsRNA, such as HT115 [ 79 , 80 ]. RNA produced by bacteria in the gut microbiota can be transported across the intestinal epithelium, as identified by RNAi feeding [ 80 ]. This transport has also been seen with non-coding RNA being transmitted from pathogenic bacteria to worms [ 81 ]. We hypothesize that unlike RNAi, this method can be used to introduce larger neuropeptides encoded by over 30 base pairs [ 82 ]. To assess if our neuropeptide delivery system utilizes previously identified RNAi mechanisms, we tested mutants deficient in the ability to transport RNA. We specifically looked into sid-1 (systemic RNA interference defective protein 1) loss of function mutants. SID-1 selectively binds to dsRNA of varying (selecting towards longer) length and not ssRNA or dsDNA [ 83 – 86 ]. We expect that our rescue by feeding approach should not be effected by the loss of SID-1 since we predict that our method is either relying on dsDNA, due to the selection of DH5α E. coli not containing T7 polymerase [ 87 ]. We found that mutants lacking sid-1 behave like wild-type animals when receiving INS-6 peptide through feeding ( Figure S7a ). Additionally, we discovered that sid-1;ins-6 double mutants fed the SCRAMBLE peptide display the ins-6 lof phenotype ( Figure S7b ). When fed INS-6, sid-1;ins-6 lof animals restored their NaCl attraction to in a pattern similar to single mutant ins-6 animals, suggesting that SID-1 is not involved in our neuropeptide rescue by feeding method. Conclusions We present a novel method of neuropeptide rescue that utilizes bacterial expression to deliver individual peptides for behavioral rescue phenotypes. Our technology is advantageous over transgenic studies, as it allows for functional characterizing individual peptides. This tool readily allows for testing newly de-orphanized neuropeptide/neuropeptide receptor pairings [ 66 ]. This genetic tool is built off the principles of RNAi feeding techniques, though for a restoration rather than a reduction of function, to supply worms with the peptide of interest through their food source as previously shown for the scorpion venom peptide mBmKTX to alter lifespan and egg-laying behavior in C. elegans [ 34 ]. Based on our results in the present study, we believe that this method can be used to restore neuropeptide function within the different class of neuropeptides in C. elegans . Our future investigation will be focused primarily on uncovering the mechanisms by which the bacteria create and deliver the neuropeptide macromolecule to C. elegans . We believe it unlikely that the C. elegans are processing the DNA. Even though DH5α E. coli is primarily used to make DNA, and does not contain T7 polymerase, it does contain E. coli RNA polymerase which could recognize additional promoter sites [ 88 ]. If the E. coli isn’t producing the RNA, then that requires the C. elegans to be doing so. Like other eukaryotes, C. elegans have 3 types of RNA polymerases which each produce a distinct type of RNA all within the nucleus [ 89 , 90 ]. For this rescue by feeding paradigm, we would expect RNA polymerase II to be producing the RNA since we expect ssRNA acting as mRNA to be produced and then fabricated into neuropeptides at the ribosome should C. elegans be the ones required to make the protein [ 90 ]. This would again require the neuropeptide vector to contain promoter sites to be recognized by RNA polymerase II [ 91 – 93 ]. If the E. coli is producing ssRNA, there are mechanisms by which this macromolecule can translocate into the nucleus, as it is becoming more open to investigation with the rise in mRNA vaccines [ 94 ]. Previous studies have shown that RNA produced by bacteria in the gut microbiota can be transported across the intestinal epithelium [ 80 , 81 ], and our vector for neuropeptide delivery is modeled after RNAi feeding [ 38 , 77 , 78 , 80 ]. Delivery of exogenous scorpion venom peptide proved effective in changing C. elegans behavior [ 34 ]. In humans, neuropeptides and neurotransmitters are produced by the gut microbiome and transferred to the nervous system for use [ 95 ]. Our neuropeptide delivery method may already make use of some mechanisms by which these other techniques function or could be using novel mechanisms of delivery. Furthermore, previous studies have shown that RNA uptake can alter transgenerational inheritance [ 96 ], despite degradation rates. Our rescue of the exploratory behavior of pdf-1 lof males even in the 24-hour timescale suggests that our feeding paradigm exploits similar mechanisms, allowing peptide-encoding mRNAs to remain present throughout the assay. We propose that if peptides were taken up, their degradation rates would likely impede rescue efficiency at later timepoints, unlike what we observe in our experiments, suggesting that the mechanism is similar to dsRNA feeding, with mRNA uptake driving rescue rather than peptide uptake. Based on our results, we propose that the neuropeptide rescue-by-feeding strategy delivers mRNA that is ready for translation by the C. elegans cellular machinery, rather than supplying C. elegans with fully translated and processed peptides. The plasma membrane of a cell is an intricate complex of multiple lipid and protein molecules. Small molecules with moderate polarity diffuse through the cell membrane passively, but most metabolites and short peptides require specialized membrane transporters for translocation [ 97 ]. Given the large number of neuropeptides encoded in the genome of C. elegans [ 1 ], having specialized transporters for peptide transport is not feasible [ 98 ]. The most substantial evidence for this statement is that the processed INS-6 peptide is 54 amino acids in length and INS-22 is 68: the C. elegans intestine expresses peptide transporters that only uptake smaller, inactive di- and tri-amino acid peptide chains [ 98 ]. Thus, rescue of chemotaxis behavior by INS-6 peptide feeding and INS-22 suggests that the mechanism of rescue may be similar to double stranded RNA (dsRNA) uptake, rather than peptidergic transport across the intestinal membrane [ 99 , 100 ]. Future investigations will see if there is a limit to the size of peptide that can be rescued. Understanding neuropeptide function is essential from both the perspective of regulating neuronal (synaptic and non-synaptic) channels of communication and from a broader view of general neuronal functions throughout the brain. Revealing how a specific neuropeptide acts at both the cellular and subcellular receptor levels is a critical link in comprehending the role of neuromodulation in circuits. An enhanced experimental pipeline for investigating peptide function will facilitate progress toward understanding how neural circuit activity within the network is modulated by neuropeptides in its various states, resulting in flexible decision-making during behaviors. Data Availability Strains ( Table S1 ) and plasmids ( Table S2 ) are available upon request. The authors affirm that all data necessary for confirming the conclusions of the article are present within the article, figures, and tables. The raw data or a summary containing the average, n, standard error measure, and associated statistical tests for all figures are available upon request. Funding This work was funded by NIH R01DC016058 (JS), NIH DP2NS132372 (RNA), and NIH F31AG081095 (EJL). Conflict of Interest EMD, DKR, and JS would like to disclose the filing of Utility Patent US-20220380430-A1 from May 20, 2022, which covers details of the neuropeptide vector and feeding. Supplemental Material Download figure Open in new tab Figure S1: Endogenous Processing of Neuropeptides in C. elegans Endogenous neuropeptide processing occurs inside neurons. From a neuropeptide precursor gene, an entire pre-propeptide is translated. We tested a representative peptide from each neuropeptide class in C. elegans. The DNA sequences for the neuropeptide precursor genes were from Wormbase.org and the putative unprocessed protein sequence and AlphaFold protein structure were obtained from uniprot.org. Once the pre-propeptide is translated, it is then processed by a series of enzymes. First the signal peptide is removed. And then the individual peptides are cleaved, at sites indicated by red arrows. We designed our neuropeptide constructs to contain these convertase enzyme cleavage sites, so we would anticipate that our delivered neuropeptide could be processed as demonstrated. Cleavage of individual peptides happens by the proprotein convertase enzymes. C. elegans have four protein convertases serving different functions in various tissues. Most common for neuropeptide processing appears to be EGL-3/KPC-2 (PC2 homolog cleaves K/R) but there are also, KPC-1 (cleaving K/R in dendrites), BLI-4/KPC-4 (cleaving K/R in the cuticle), and AEX-5/KPC-3 (cleaving paired basic amino acids in the muscle and intestine) (last three are PC1 homologs) [ 56 , 101 – 103 ]. After protein cleavage creates individual neuropeptides, the peptides can be post-translationally modified. The FLP [ 68 ] and NLP peptides are often amidated [ 19 ] while INS peptides generally have disulfide bonds running between their α and β chains [ 58 , 63 ]. Once the neuropeptides are processed, they are packaged into dense core vesicles for release at the synapse. They can be released with or without neurotransmitters. After binding to GPCRs on post-synaptic neurons, they slowly diffuse away from synapse and are broken down; this occurs at a slower rate than neurotransmitter reuptake leading to longer lasting neuropeptide effects [ 18 , 104 ]. Created in BioRender. DiLoreto, E. (2025) https://BioRender.com/dyorxwg Download figure Open in new tab Figure S2: Neuropeptide gene deficient animals exhibit different behaviors than they wildtype counterparts A) pdf-1;him-5 males fed OP50 without peptide have a significantly lower rate of leaving food beyond 35 mm compared to wildtype him-5 animals (****p ≤ 0.0001, unpaired t-test). B) The location of males can be traced across time and binned as animals who never left food (0 mm), those that had a minor excursion (10 mm >), and those with a major excursion (10 mm <). This is then converted to a percentage and plotted across time. These values contribute to the probability of leaving rate. pdf-1 animals fed OP50 without peptide have lower rates of major excursions compared to wildtype him-5 animals. C) SCRAMBLE DH5α E. coli fed pdf-1 lof males have a lower percentage of animals making major excursions off of food than him-5 animals. D) Compared to wildtype him-8 males, flp-3;him-8 lof males fed OP50 E. coli without peptide avoid ascr#8 at a significantly higher rate (****p ≤ 0.0001, Mann-Whitney test). E) Compared to wildtype animals, ins-6 animals fed OP50 E. coli without peptide have a lower choice index towards high 750 mm NaCl (****p ≤ 0.0001, unpaired t-test). Download figure Open in new tab Figure S3: Bacterial cell supernatant from DH5α cells liquid culture growth alone may be sufficient to restore neuropeptide behavior him-8 lof males fed the supernatant or cells derived from fed DH5α bacterial culture expressing the SCRAMBLE or FLP-3-9 peptide did not alter the lack of avoidance towards ascr#8. flp-3;him-8 males fed the supernatant from a DH5α culture expressing FLP-3-9 did exhibit a suppression of avoidance behavior. (comparisons between ascr#8 stimulus (+) conditions within genotypes, ns p ≥ 0.05, *p ≤ 0.05, **p ≤ 0.01,****p ≤ 0.0001, One-way ANOVA with Tukey’s multiple comparison) Download figure Open in new tab Figure S4: Plasmid maps of old Gateway cloning and new constructions A) pDest-527 vector used in Gateway cloning. Created in SnapGene B) pET-21a(+) vector used in Genscript XhoI/XhoI construction. Created in SnapGene C) Chemotaxis values of wildtype (N2 Bristol) and ins-22 lof animals towards 10% butanone. (***p ≤ 0.001, Mann-Whitney test). Download figure Open in new tab Figure S5: Neuropeptide receptor lof animals exhibit defective behavior without peptide feeding A) pdf-1;pdfr-1 lof in a him-5 background do leave food greater than 35 mm at a higher rate than pdfr-1;him-5 lof males (****p ≤ 0.0001, unpaired t-test). B) Excursion rates of neuropeptide receptor mutants ( pdfr-1;him-5 ) and neuropeptide/neuropeptide receptor mutants ( pdf-1;pdfr-1;him-5 ) fed OP50 E. coli do not readily leave food or have a major excursion 10 mm <. C) pdf-1;him-5 neuropeptide receptor mutants fed PDF-1 peptides in DH5αa E. coli do not have excursions off food at high rates like him-5 males. D) flp-3;frpr-16 double mutants in a him-8 background avoid ascr#8 at a higher rate than the solvent control (****p ≤ 0.0001, Mann-Whitney test). Download figure Open in new tab Figure S6: Overexpression of wildtype animals fed neuropeptide in DH5α or iOP50 E. coli A) Most him-5 males fed SCRAMBLE or PDF-1 peptides in DH5α E. coli made a major excursions traveling < 10 mm from food by 2 hours after plating. B) him-5 males do not remain on food at the rates of pdf-1;him-5 animals fed PDF-1 peptides in iOP50 E. coli and tested on iOP50 assay plates containing peptides. pdf-1;him-5 males fed PDF-1 peptides in iOP50 E. coli have excursions off food at higher rates than SCRAMBLE-fed animals. C) him-5 males fed PDF-1 peptides in iOP50 E. coli and then tested on OP50 assay plates not containing peptide, do not have excursions leaving food more than 35 mm at higher rates than SCRAMBLE fed males (*p ≤ 0.05, **p ≤ 0.01,****p ≤ 0.0001, One-way ANOVA with Dunnett’s post-hoc test). D) him-5 males do not remain on food at the rates of pdf-1;him-5 animals fed PDF-1 peptides in iOP50 E. coli and tested in OP50 assay plates not containing peptides. Download figure Open in new tab Figure S7: Investigating putative neuropeptide uptake mechanisms A) Choice index of OP50 fed animals moving towards 0 or 750 mM NaCl. Mutants lacking ins-6 showed reduced preference for 750 mM NaCl. ( ns p ≥ 0.05, *p ≤ 0.05, **p ≤ 0.01,****p ≤ 0.0001, One-way ANOVA with Dunnett’s multiple comparison). B) Choice index of dsRNA transport mutant animals ( sid - 1 ) demonstrated that when fed DH5α bacteria expressing SCRAMBLE peptide both ins-6 lof and sid-1;ins-6 lof animals displayed defective NaCl attraction. After feeding of DH5α E. coli expressing INS-6, there was no statistically significant difference in the behavior towards NaCl compared to wildtype animals. (comparisons made within peptide feeding condition, ns p ≥ 0.05, *p ≤ 0.05, **p ≤ 0.01,****p ≤ 0.0001, One-way ANOVA with Dunnett’s multiple comparison). View this table: View inline View popup Download powerpoint Table S1: C. elegans Strains Used in Current Study View this table: View inline View popup Download powerpoint Table S2: Neuropeptide Oligo Sequences Ordered for Individual Peptide Feeding Neuropeptide DNA sequence indicated in lowercase. Acknowledgments We thank Prof. Frank Schroeder, Cornell University, for providing ascr#8 and Prof. Victor Ambros for reagents. We want to thank Dr. Arantza Barrios for help in executing the leaving assay analysis in R. We extend our thanks to Dr. Sreekanth H. Chalasani and Dr. Douglas Portman for their insights and updates to the method for testing the phenotypes related to ins-6 and pdf-1 , respectively. pDest-527 was a gift from Dominic Esposito (Addgene plasmid # 11518; http://n2t.net/addgene:11518 ; RRID:Addgene_11518). We thank the Caenorhabditis Genetics Center for supplying some strains; the CGC is funded by NIH Office of Research Infrastructure Programs (P40 OD010440). The INS-22 strain was provided by the C. elegans Gene Knockout Project at the Oklahoma Medical Research Foundation, which was part of the International C. elegans Gene Knockout Consortium. Funder Information Declared NIH , R01DC016058 , DP2NS132372 Footnotes This version addresses issues raised by reviewers about the induction of Peptide using IPTG. References 1. ↵ Li , C. and K. Kim , Neuropeptides . WormBook : the online review of C. elegans biology , 2008 : p. 1 – 36 . 2. ↵ Dale Purves , G.J.A. , David Fitzpatrick , William C Hall , Anthony-Samuel LaMantia , Richard D Mooney , Michael L Platt , Leonard E White , Neuroscience . 6 ed . 2018 , Sunderland, MA: Oxford University Press . 3. ↵ Yañez-Guerra , L.A. , D. Thiel , and G. Jékely , Premetazoan Origin of Neuropeptide Signaling . Mol Biol Evol , 2022 . 39 ( 4 ). 4. ↵ Beets , I. , et al. , Vasopressin/oxytocin-related signaling regulates gustatory associative learning in C. elegans . Science , 2012 . 338 ( 6106 ): p. 543 – 5 . OpenUrl Abstract / FREE Full Text 5. Gruber , C.W ., Physiology of invertebrate oxytocin and vasopressin neuropeptides . Experimental Physiology , 2014 . 99 ( 1 ): p. 55 – 61 . OpenUrl CrossRef PubMed 6. Insel , T.R. and L.J. Young , The neurobiology of attachment . Nature Reviews Neuroscience , 2001 . 2 ( 2 ): p. 129 – 136 . OpenUrl CrossRef PubMed Web of Science 7. Willets , J.M. , et al. , Regulation of oxytocin receptor responsiveness by G protein-coupled receptor kinase 6 in human myometrial smooth muscle . Molecular endocrinology (Baltimore, Md.) , 2009 . 23 ( 8 ): p. 1272 – 1280 . OpenUrl CrossRef PubMed 8. Lukas , M. , et al. , The Neuropeptide Oxytocin Facilitates Pro-Social Behavior and Prevents Social Avoidance in Rats and Mice . Neuropsychopharmacology , 2011 . 36 ( 11 ): p. 2159 – 2168 . OpenUrl CrossRef PubMed Web of Science 9. ↵ Odekunle , E.A. , et al. , Ancient role of vasopressin/oxytocin-type neuropeptides as regulators of feeding revealed in an echinoderm . BMC Biology , 2019 . 17 ( 1 ): p. 60 . OpenUrl CrossRef PubMed 10. ↵ Garrison , J.L. , et al. , Oxytocin/vasopressin-related peptides have an ancient role in reproductive behavior . Science , 2012 . 338 ( 6106 ): p. 540 – 3 . OpenUrl Abstract / FREE Full Text 11. ↵ Frooninckx , L. , et al. , Neuropeptide GPCRs in C. elegans . Frontiers in Endocrinology , 2012 . 3 ( 167 ). 12. ↵ Nusbaum , M.P. , D.M. Blitz , and E. Marder , Functional consequences of neuropeptide and small-molecule co-transmission . Nat Rev Neurosci , 2017 . 18 ( 7 ): p. 389 – 403 . OpenUrl CrossRef PubMed 13. ↵ Souza-Moreira , L. , et al. , Neuropeptides as pleiotropic modulators of the immune response . Neuroendocrinology , 2011 . 94 ( 2 ): p. 89 – 100 . OpenUrl CrossRef PubMed Web of Science 14. ↵ Nässel , D.R. and M. Zandawala , Endocrine cybernetics: neuropeptides as molecular switches in behavioural decisions . Open Biol , 2022 . 12 ( 7 ): p. 220174 . OpenUrl CrossRef PubMed 15. ↵ Tai , K.Y. , et al. , Selected neuropeptide genes show genetic differentiation between Africans and non-Africans . BMC Genetics , 2020 . 21 ( 1 ): p. 31 . OpenUrl PubMed 16. PeptidesDB . 2008 April 30 2008 [cited 2022; Available from: / www.peptides.be . 17. Burbach , J.P.H ., Neuropeptides from concept to online database www.neuropeptides.nl . European Journal of Pharmacology , 2010 . 626 ( 1 ): p. 27 – 48 . OpenUrl CrossRef PubMed Web of Science 18. ↵ Russo , A.F ., Overview of Neuropeptides: Awakening the Senses? Headache , 2017 . 57 Suppl 2 ( Suppl 2 ): p. 37 – 46 . OpenUrl CrossRef PubMed 19. ↵ Van Bael , S. , et al. , Mass spectrometric evidence for neuropeptide-amidating enzymes in Caenorhabditis elegans . J Biol Chem , 2018 . 293 ( 16 ): p. 6052 – 6063 . OpenUrl Abstract / FREE Full Text 20. ↵ White , J.G. , et al. , The structure of the nervous system of the nematode Caenorhabditis elegans . Philos Trans R Soc Lond B Biol Sci , 1986 . 314 ( 1165 ): p. 1 – 340 . OpenUrl CrossRef PubMed 21. ↵ Sammut , M. , et al. , Glia-derived neurons are required for sex-specific learning in C. elegans . Nature , 2015 . 526 ( 7573 ): p. 385 – 390 . OpenUrl CrossRef PubMed 22. ↵ Li , C. , K. Kim , and L.S. Nelson , FMRFamide-related neuropeptide gene family in Caenorhabditis elegans . Brain Res , 1999 . 848 ( 1-2 ): p. 26 – 34 . OpenUrl CrossRef PubMed Web of Science 23. ↵ Pierce , S.B. , et al. , Regulation of DAF-2 receptor signaling by human insulin and ins-1, a member of the unusually large and diverse C. elegans insulin gene family . Genes Dev , 2001 . 15 ( 6 ): p. 672 – 86 . OpenUrl Abstract / FREE Full Text 24. ↵ Nathoo , A.N. , et al. , Identification of neuropeptide-like protein gene families in Caenorhabditiselegans and other species . Proc Natl Acad Sci U S A , 2001 . 98 ( 24 ): p. 14000 – 5 . OpenUrl Abstract / FREE Full Text 25. ↵ Hobert , O. , The neuronal genome of Caenorhabditis elegans ., in WormBook: The Online Review of C. elegans Biology . 2005 – 2018 : Pasadena, CA. 26. ↵ Watteyne , J. , et al. , Neuropeptide signaling network of Caenorhabditis elegans: from structure to behavior . Genetics , 2024 . 228 ( 3 ). 27. ↵ Barrios , A. , et al. , PDF-1 neuropeptide signaling modulates a neural circuit for mate-searching behavior in C. elegans . Nature Neuroscience , 2012 . 15 ( 12 ): p. 1675 – 1684 . OpenUrl CrossRef PubMed 28. Hussey , R. , et al. , Oxygen-sensing neurons reciprocally regulate peripheral lipid metabolism via neuropeptide signaling in Caenorhabditis elegans . PLoS genetics , 2018 . 14 ( 3 ): p. e1007305 – e1007305 . OpenUrl CrossRef 29. Nath , R.D. , et al. , C. elegans Stress-Induced Sleep Emerges from the Collective Action of Multiple Neuropeptides . Current biology , 2016 . 26 ( 18 ): p. 2446 – 2455 . OpenUrl CrossRef PubMed 30. ↵ Nelson , M.D. , et al. , FRPR-4 Is a G-Protein Coupled Neuropeptide Receptor That Regulates Behavioral Quiescence and Posture in Caenorhabditis elegans . PLoS One , 2015 . 10 ( 11 ): p. e0142938 . OpenUrl CrossRef PubMed 31. ↵ Van Bael , S. , et al. , Identification of Endogenous Neuropeptides in the Nematode C. elegans Using Mass Spectrometry . Methods Mol Biol , 2018 . 1719 : p. 271 – 291 . OpenUrl CrossRef PubMed 32. ↵ Papaioannou , S. , et al. , Role of a FMRFamide-like family of neuropeptides in the pharyngeal nervous system of Caenorhabditis elegans . Journal of Neurobiology , 2005 . 65 ( 3 ): p. 304 – 319 . OpenUrl CrossRef PubMed Web of Science 33. ↵ Ohno , H. , et al. , Luqin-like RYamide peptides regulate food-evoked responses in C. elegans . Elife , 2017 . 6 . 34. ↵ Xu , J. , et al. , Feeding recombinant E. coli with GST-mBmKTX fusion protein increases the fecundity and lifespan of Caenorhabditis elegans . Peptides , 2017 . 89 : p. 1 – 8 . OpenUrl CrossRef PubMed 35. ↵ Fraser , A.G. , et al. , Functional genomic analysis of C. elegans chromosome I by systematic RNA interference . Nature , 2000 . 408 ( 6810 ): p. 325 – 330 . OpenUrl CrossRef PubMed Web of Science 36. ↵ Kamath , R.S. , et al. , Effectiveness of specific RNA-mediated interference through ingested double-stranded RNA in Caenorhabditis elegans . Genome Biol , 2001 . 2 . 37. ↵ Dirksen , P. , et al. , CeMbio - The Caenorhabditis elegans Microbiome Resource . G3 (Bethesda) , 2020 . 10 ( 9 ): p. 3025 – 3039 . OpenUrl Abstract / FREE Full Text 38. ↵ Reilly , D.K. , et al. , Distinct neuropeptide-receptor modules regulate a sex-specific behavioral response to a pheromone . Commun Biol , 2021 . 4 ( 1 ): p. 1018 . OpenUrl CrossRef PubMed 39. ↵ Brenner , S ., The genetics of Caenorhabditis elegans . Genetics , 1974 . 77 ( 1 ): p. 71 – 94 . OpenUrl Abstract / FREE Full Text 40. ↵ Neve , I.A.A. , et al. , Escherichia coli Metabolite Profiling Leads to the Development of an RNA Interference Strain for Caenorhabditis elegans . G3 (Bethesda) , 2020 . 10 ( 1 ): p. 189 – 198 . OpenUrl Abstract / FREE Full Text 41. ↵ Ryan , D.A. , et al. , Sex, age, and hunger regulate behavioral prioritization through dynamic modulation of chemoreceptor expression . Curr Biol , 2014 . 24 ( 21 ): p. 2509 – 17 . OpenUrl CrossRef PubMed 42. ↵ Barrios , A. , et al. , PDF-1 neuropeptide signaling modulates a neural circuit for mate-searching behavior in C. elegans . Nat Neurosci , 2012 . 15 ( 12 ): p. 1675 – 82 . OpenUrl CrossRef PubMed 43. ↵ Lipton , J. , et al. , Mate searching in Caenorhabditis elegans: a genetic model for sex drive in a simple invertebrate . J Neurosci , 2004 . 24 ( 34 ): p. 7427 – 34 . OpenUrl Abstract / FREE Full Text 44. ↵ Hilliard , M.A. , et al. , Worms taste bitter: ASH neurons, QUI-1, GPA-3 and ODR-3 mediate quinine avoidance in Caenorhabditis elegans . EMBO J , 2004 . 23 ( 5 ): p. 1101 – 11 . OpenUrl Abstract / FREE Full Text 45. ↵ Leinwand , S.G. and S.H. Chalasani , Neuropeptide signaling remodels chemosensory circuit composition in Caenorhabditis elegans . Nature neuroscience , 2013 . 16 ( 10 ): p. 1461 – 1467 . OpenUrl CrossRef PubMed 46. ↵ Bargmann , C.I. and H.R. Horvitz , Chemosensory neurons with overlapping functions direct chemotaxis to multiple chemicals in C. elegans . Neuron , 1991 . 7 ( 5 ): p. 729 – 42 . OpenUrl CrossRef PubMed Web of Science 47. ↵ Phillips , C.M. , et al. , HIM-8 binds to the X chromosome pairing center and mediates chromosome-specific meiotic synapsis . Cell , 2005 . 123 ( 6 ): p. 1051 – 63 . OpenUrl CrossRef PubMed Web of Science 48. ↵ Meneely , P.M. , et al. , Crossover distribution and frequency are regulated by him-5 in Caenorhabditis elegans . Genetics , 2012 . 190 ( 4 ): p. 1251 – 66 . OpenUrl Abstract / FREE Full Text 49. ↵ Reilly , D.K ., Neuromodulation of Sex-Specific Pheromone-Mediated Behaviors , in Biology and Biotechnology . 2020 , Worcester Polytechnic Institute : Worcester, MA . p. 519 . 50. ↵ Janssen , T. , et al. , Functional characterization of three G protein-coupled receptors for pigment dispersing factors in Caenorhabditis elegans . J Biol Chem , 2008 . 283 ( 22 ): p. 15241 – 9 . OpenUrl Abstract / FREE Full Text 51. ↵ Janssen , T. , et al. , Discovery and characterization of a conserved pigment dispersing factor-like neuropeptide pathway in Caenorhabditis elegans . J Neurochem , 2009 . 111 ( 1 ): p. 228 – 41 . OpenUrl CrossRef PubMed 52. ↵ Muirhead , C.S. and J. Srinivasan , Small molecule signals mediate social behaviors in C. elegans . J Neurogenet , 2020 . 34 ( 3-4 ): p. 395 – 403 . OpenUrl CrossRef PubMed 53. ↵ Pungaliya , C. , et al. , A shortcut to identifying small molecule signals that regulate behavior and development in Caenorhabditis elegans . Proc Natl Acad Sci U S A , 2009 . 106 ( 19 ): p. 7708 – 13 . OpenUrl Abstract / FREE Full Text 54. ↵ Salama , R. , E. DiLoreto , and J. Srinivasan , The Architect of Neurotransmission in C. elegans : How FLP-3 Neuropeptides’ Structures Direct their Function . MicroPubl Biol , 2023 . 2023 . 55. ↵ Chen , Z. , et al. , Two insulin-like peptides antagonistically regulate aversive olfactory learning in C. elegans . Neuron , 2013 . 77 ( 3 ): p. 572 – 585 . OpenUrl CrossRef PubMed Web of Science 56. ↵ Hung , W.L. , et al. , A Caenorhabditis elegans developmental decision requires insulin signaling-mediated neuron-intestine communication . Development , 2014 . 141 ( 8 ): p. 1767 – 79 . OpenUrl Abstract / FREE Full Text 57. ↵ Hua , Q.-X. , et al. , A divergent INS protein in Caenorhabditis elegans structurally resembles human insulin and activates the human insulin receptor . Genes & development , 2003 . 17 ( 7 ): p. 826 – 831 . OpenUrl Abstract / FREE Full Text 58. ↵ Zheng , S. , et al. , A functional study of all 40 Caenorhabditis elegans insulin-like peptides . J Biol Chem , 2018 . 293 ( 43 ): p. 16912 – 16922 . OpenUrl Abstract / FREE Full Text 59. ↵ Leinwand , S.G. and S.H. Chalasani , Neuropeptide signaling remodels chemosensory circuit composition in Caenorhabditis elegans . Nat Neurosci , 2013 . 16 ( 10 ): p. 1461 – 7 . OpenUrl CrossRef PubMed 60. ↵ Gao , B. and Q. Sun , Programming gene expression in multicellular organisms for physiology modulation through engineered bacteria . Nature Communications , 2021 . 12 ( 1 ): p. 2689 . OpenUrl CrossRef PubMed 61. ↵ Carrillo Rincón , A.F. , et al. , A dual-inducible control system for multistep biosynthetic pathways . Journal of Biological Engineering , 2024 . 18 ( 1 ): p. 68 . OpenUrl CrossRef PubMed 62. ↵ Shtonda , B.B. and L. Avery , Dietary choice behavior in Caenorhabditis elegans . J Exp Biol , 2006 . 209 (Pt 1 ): p. 89 – 102 . OpenUrl Abstract / FREE Full Text 63. ↵ Zhu , R. and I.D. Chin-Sang , C. elegans insulin-like peptides . Mol Cell Endocrinol , 2024 . 585 : p. 112173 . OpenUrl CrossRef PubMed 64. ↵ Chen , Y. and L.R. Baugh , Ins-4 and daf-28 function redundantly to regulate C. elegans L1 arrest . Dev Biol , 2014 . 394 ( 2 ): p. 314 – 26 . OpenUrl CrossRef PubMed 65. ↵ Ripoll-Sánchez , L. , et al. , The neuropeptidergic connectome of C. elegans . Neuron , 2023 . 111 ( 22 ): p. 3570 – 3589.e5 . OpenUrl CrossRef PubMed 66. ↵ Beets , I. , et al. , System-wide mapping of peptide-GPCR interactions in C. elegans . Cell Rep , 2023 . 42 ( 9 ): p. 113058 . OpenUrl CrossRef PubMed 67. ↵ Hilbert , Z.A. and D.H. Kim , PDF-1 neuropeptide signaling regulates sexually dimorphic gene expression in shared sensory neurons of C. elegans . Elife , 2018 . 7 . 68. ↵ Li , C. and K. Kim , Family of FLP Peptides in Caenorhabditis elegans and Related Nematodes . Frontiers in Endocrinology , 2014 . 5 . 69. ↵ Van Bael , S. , et al. , Identification of Endogenous Neuropeptides in the Nematode C. elegans Using Mass Spectrometry . Methods in molecular biology (Clifton, N.J.) , 2018 . 1719 : p. 271 – 291 . OpenUrl CrossRef PubMed 70. Bael , S.V ., Neuropeptidomics in C. elegans, in Biochemistry and Biotechnology . 2018 , KU Leuven: Betekom, Belgium . p. 216 . 71. ↵ Van Bael , S. , et al. , A Caenorhabditis elegans Mass Spectrometric Resource for Neuropeptidomics . J Am Soc Mass Spectrom , 2018 . 29 ( 5 ): p. 879 – 889 . OpenUrl CrossRef PubMed 72. ↵ Torayama , I. , T. Ishihara , and I. Katsura , Caenorhabditis elegans integrates the signals of butanone and food to enhance chemotaxis to butanone . J Neurosci , 2007 . 27 ( 4 ): p. 741 – 50 . OpenUrl Abstract / FREE Full Text 73. ↵ L’Etoile , N.D. and C.I. Bargmann , Olfaction and odor discrimination are mediated by the C. elegans guanylyl cyclase ODR-1 . Neuron , 2000 . 25 ( 3 ): p. 575 – 86 . OpenUrl CrossRef PubMed Web of Science 74. ↵ Timmons , L. , D.L. Court , and A. Fire , Ingestion of bacterially expressed dsRNAs can produce specific and potent genetic interference in Caenorhabditis elegans . Gene , 2001 . 263 ( 1-2 ): p. 103 – 12 . OpenUrl CrossRef PubMed Web of Science 75. ↵ Fire , A. , et al. , Potent and specific genetic interference by double-stranded RNA in Caenorhabditis elegans . Nature , 1998 . 391 ( 6669 ): p. 806 – 11 . OpenUrl CrossRef PubMed Web of Science 76. ↵ Timmons , L. and A. Fire , Specific interference by ingested dsRNA . Nature , 1998 . 395 ( 6705 ): p. 854 . OpenUrl CrossRef PubMed Web of Science 77. ↵ Conte , D. , Jr. , et al. , RNA Interference in Caenorhabditis elegans . Current protocols in molecular biology , 2015 . 109 : p. 26.3.1 – 26.3.30 . OpenUrl 78. ↵ Fraser , A.G. , et al. , Functional genomic analysis of C. elegans chromosome I by systematic RNA interference . Nature , 2000 . 408 ( 6810 ): p. 325 – 30 . OpenUrl CrossRef PubMed Web of Science 79. ↵ García , K. , et al. , Inactivated E. coli transformed with plasmids that produce dsRNA against infectious salmon anemia virus hemagglutinin show antiviral activity when added to infected ASK cells . Front Microbiol , 2015 . 6 : p. 300 . OpenUrl PubMed 80. ↵ Kamath , R.S. , et al. , Effectiveness of specific RNA-mediated interference through ingested double-stranded RNA in Caenorhabditis elegans . Genome Biol , 2001 . 2 ( 1 ): p. RESEARCH0002 . OpenUrl CrossRef PubMed 81. ↵ Kaletsky , R. , et al. , C. elegans interprets bacterial non-coding RNAs to learn pathogenic avoidance . Nature , 2020 . 586 ( 7829 ): p. 445 – 451 . OpenUrl CrossRef PubMed 82. ↵ Weber , F. , et al. , Double-stranded RNA is produced by positive-strand RNA viruses and DNA viruses but not in detectable amounts by negative-strand RNA viruses . J Virol , 2006 . 80 ( 10 ): p. 5059 – 64 . OpenUrl Abstract / FREE Full Text 83. ↵ Shih , J.D. and C.P. Hunter , SID-1 is a dsRNA-selective dsRNA-gated channel . RNA (New York, N.Y.) , 2011 . 17 ( 6 ): p. 1057 – 1065 . OpenUrl Abstract / FREE Full Text 84. Shih , J.D. , et al. , The SID-1 double-stranded RNA transporter is not selective for dsRNA length . Rna , 2009 . 15 ( 3 ): p. 384 – 90 . OpenUrl Abstract / FREE Full Text 85. Cryo-EM structure reveals how SID-1 recognizes dsRNA that initiates systemic RNAi . Nat Struct Mol Biol , 2024 . 31 ( 7 ): p. 1007 – 1008 . OpenUrl CrossRef PubMed 86. ↵ Li , W. , et al. , Systemic RNA Interference Deficiency-1 (SID-1) Extracellular Domain Selectively Binds Long Double-stranded RNA and Is Required for RNA Transport by SID-1 . J Biol Chem , 2015 . 290 ( 31 ): p. 18904 – 13 . OpenUrl Abstract / FREE Full Text 87. ↵ Kostylev , M. , et al. , Cloning Should Be Simple: Escherichia coli DH5 α -Mediated Assembly of Multiple DNA Fragments with Short End Homologies . PLoS One , 2015 . 10 ( 9 ): p. e0137466 . OpenUrl CrossRef PubMed 88. ↵ Shimada , T. , et al. , The whole set of constitutive promoters recognized by RNA polymerase RpoD holoenzyme of Escherichia coli . PLoS One , 2014 . 9 ( 3 ): p. e90447 . OpenUrl CrossRef PubMed 89. ↵ Carter , R. and G. Drouin , Structural differentiation of the three eukaryotic RNA polymerases . Genomics , 2009 . 94 ( 6 ): p. 388 – 96 . OpenUrl CrossRef PubMed 90. ↵ Girbig , M. , A.D. Misiaszek , and C.W. Müller , Structural insights into nuclear transcription by eukaryotic DNA-dependent RNA polymerases . Nature Reviews Molecular Cell Biology , 2022 . 23 ( 9 ): p. 603 – 622 . OpenUrl CrossRef PubMed 91. ↵ Chen , R.A. , et al. , The landscape of RNA polymerase II transcription initiation in C. elegans reveals promoter and enhancer architectures . Genome Res , 2013 . 23 ( 8 ): p. 1339 – 47 . OpenUrl Abstract / FREE Full Text 92. Bowman , E.A. and W.G. Kelly , RNA polymerase II transcription elongation and Pol II CTD Ser2 phosphorylation: A tail of two kinases . Nucleus , 2014 . 5 ( 3 ): p. 224 – 36 . OpenUrl CrossRef PubMed 93. ↵ Zhu , Y. , et al. , Quantitative analysis of transcription start site selection reveals control by DNA sequence, RNA polymerase II activity and NTP levels . Nat Struct Mol Biol , 2024 . 31 ( 1 ): p. 190 – 202 . OpenUrl CrossRef PubMed 94. ↵ Sattar , S. , et al. , Nuclear translocation of spike mRNA and protein is a novel feature of SARS-CoV-2 . Front Microbiol , 2023 . 14 : p. 1073789 . OpenUrl CrossRef PubMed 95. ↵ Leeuwendaal , N.K. , J.F. Cryan , and H. Schellekens , Gut peptides and the microbiome: focus on ghrelin . Curr Opin Endocrinol Diabetes Obes , 2021 . 28 ( 2 ): p. 243 – 252 . OpenUrl CrossRef PubMed 96. ↵ Seydoux , G. and A. Fire , Soma-germline asymmetry in the distributions of embryonic RNAs in Caenorhabditis elegans . Development , 1994 . 120 ( 10 ): p. 2823 – 34 . OpenUrl Abstract 97. ↵ Yang , N.J. and M.J. Hinner , Getting across the cell membrane: an overview for small molecules, peptides, and proteins. Methods in molecular biology (Clifton , N.J .), 2015 . 1266 : p. 29 – 53 . OpenUrl 98. ↵ Meissner , B. , et al. , Deletion of the intestinal peptide transporter affects insulin and TOR signaling in Caenorhabditis elegans . J Biol Chem , 2004 . 279 ( 35 ): p. 36739 – 45 . OpenUrl Abstract / FREE Full Text 99. ↵ Rao , M. and S. Sockanathan , Molecular mechanisms of RNAi: Implications for development and disease . Birth Defects Research Part C: Embryo Today: Reviews , 2005 . 75 ( 1 ): p. 28 – 42 . OpenUrl CrossRef PubMed 100. ↵ Bernstein , E. , et al. , Role for a bidentate ribonuclease in the initiation step of RNA interference . Nature , 2001 . 409 ( 6818 ): p. 363 – 6 . OpenUrl CrossRef PubMed Web of Science 101. ↵ Kass , J. , et al. , The EGL-3 proprotein convertase regulates mechanosensory responses of Caenorhabditis elegans . J Neurosci , 2001 . 21 ( 23 ): p. 9265 – 72 . OpenUrl Abstract / FREE Full Text 102. Li , C. and K. Kim , Neuropeptides, in WormBook: The Online Review of C. elegans Biology . 2018 . 103. ↵ Husson , S.J. , et al. , Defective processing of neuropeptide precursors in Caenorhabditis elegans lacking proprotein convertase 2 (KPC-2/EGL-3): mutant analysis by mass spectrometry . J Neurochem , 2006 . 98 ( 6 ): p. 1999 – 2012 . OpenUrl CrossRef PubMed Web of Science 104. ↵ G. Siegel Mains , R. and B. Eipper , The Neuropeptides , in Basic Neurochemistry: Molecular, Cellular and Medical Aspects ., G. Siegel , et al. , Editors. 1999 , Lippincott-Raven: Philadelphia . View the discussion thread. Back to top Previous Next Posted May 28, 2025. Download PDF Data/Code Email Thank you for your interest in spreading the word about bioRxiv. NOTE: Your email address is requested solely to identify you as the sender of this article. Your Email * Your Name * Send To * Enter multiple addresses on separate lines or separate them with commas. You are going to email the following Harnessing Microbial Tools: Escherichia coli as a Vehicle for Neuropeptide Functional Analysis in Caenorhabditis elegans Message Subject (Your Name) has forwarded a page to you from bioRxiv Message Body (Your Name) thought you would like to see this page from the bioRxiv website. Your Personal Message CAPTCHA This question is for testing whether or not you are a human visitor and to prevent automated spam submissions. Share Harnessing Microbial Tools: Escherichia coli as a Vehicle for Neuropeptide Functional Analysis in Caenorhabditis elegans Elizabeth M. DiLoreto , Shruti Shastry , Emily J. Leptich , Douglas K. Reilly , Rachel N. Arey , Jagan Srinivasan bioRxiv 2025.03.03.641308; doi: https://doi.org/10.1101/2025.03.03.641308 Share This Article: Copy Citation Tools Harnessing Microbial Tools: Escherichia coli as a Vehicle for Neuropeptide Functional Analysis in Caenorhabditis elegans Elizabeth M. DiLoreto , Shruti Shastry , Emily J. Leptich , Douglas K. Reilly , Rachel N. Arey , Jagan Srinivasan bioRxiv 2025.03.03.641308; doi: https://doi.org/10.1101/2025.03.03.641308 Citation Manager Formats BibTeX Bookends EasyBib EndNote (tagged) EndNote 8 (xml) Medlars Mendeley Papers RefWorks Tagged Ref Manager RIS Zotero Tweet Widget Facebook Like Google Plus One Subject Area Neuroscience Subject Areas All Articles Animal Behavior and Cognition (7635) Biochemistry (17691) Bioengineering (13892) Bioinformatics (41937) Biophysics (21452) Cancer Biology (18589) Cell Biology (25504) Clinical Trials (138) Developmental Biology (13378) Ecology (19899) Epidemiology (2067) Evolutionary Biology (24320) Genetics (15609) Genomics (22506) Immunology (17736) Microbiology (40394) Molecular Biology (17181) Neuroscience (88605) Paleontology (666) Pathology (2832) Pharmacology and Toxicology (4824) Physiology (7641) Plant Biology (15156) Scientific Communication and Education (2045) Synthetic Biology (4294) Systems Biology (9825) Zoology (2271)

Text is read by the "Ask this paper" AI Q&A widget below. Extraction quality varies by source — PMC NXML preserves structure cleanly, OA-HTML may include some navigation residue, and OA-PDF can have broken hyphenation. The publisher copy (via DOI) is the canonical version.

My notes (saved in your browser only)

Ask this paper AI returns verbatim quotes from the full text · source: preprint-html

Answers must be backed by verbatim quotes from this paper's full text. Hallucinated quotes are dropped automatically; if no verbatim passage answers the question, we say so. How this works

Citation neighborhood (no data yet)

We don't have any in-corpus citations linked to this paper yet. This is a recent paper (2025) — citers typically take a year or two to land, and the OpenAlex reference graph may still be filling in.

Source provenance

europepmc
last seen: 2026-05-20T01:45:00.602351+00:00
unpaywall
last seen: 2026-06-13T06:42:57.164913+00:00