{"paper_id":"296039e5-a682-4869-afeb-1f71a15da0b7","body_text":"Structural and Functional Implications of... | F1000Research <!-- --> <!-- --> <!-- This is commented out to fix display problems on mobile devices. We may use it again once we implement a responsive design that supports native device resolutions. --> \"use strict\";function _typeof(t){return(_typeof=\"function\"==typeof Symbol&&\"symbol\"==typeof Symbol.iterator?function(t){return typeof t}:function(t){return t&&\"function\"==typeof Symbol&&t.constructor===Symbol&&t!==Symbol.prototype?\"symbol\":typeof t})(t)}!function(){var t=function(){var t,e,o=[],n=window,r=n;for(;r;){try{if(r.frames.__tcfapiLocator){t=r;break}}catch(t){}if(r===n.top)break;r=r.parent}t||(!function t(){var e=n.document,o=!!n.frames.__tcfapiLocator;if(!o)if(e.body){var r=e.createElement(\"iframe\");r.style.cssText=\"display:none\",r.name=\"__tcfapiLocator\",e.body.appendChild(r)}else setTimeout(t,5);return!o}(),n.__tcfapi=function(){for(var t=arguments.length,n=new Array(t),r=0;r 3&&2===parseInt(n[1],10)&&\"boolean\"==typeof n[3]&&(e=n[3],\"function\"==typeof n[2]&&n[2](\"set\",!0)):\"ping\"===n[0]?\"function\"==typeof n[2]&&n[2]({gdprApplies:e,cmpLoaded:!1,cmpStatus:\"stub\"}):o.push(n)},n.addEventListener(\"message\",(function(t){var e=\"string\"==typeof t.data,o={};if(e)try{o=JSON.parse(t.data)}catch(t){}else o=t.data;var n=\"object\"===_typeof(o)&&null!==o?o.__tcfapiCall:null;n&&window.__tcfapi(n.command,n.version,(function(o,r){var a={__tcfapiReturn:{returnValue:o,success:r,callId:n.callId}};t&&t.source&&t.source.postMessage&&t.source.postMessage(e?JSON.stringify(a):a,\"*\")}),n.parameter)}),!1))};\"undefined\"!=typeof module?module.exports=t:t()}(); dataLayer = dataLayer || []; // Standard GTM initialization - Google Consent Mode handles consent automatically (function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start': new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0], j=d.createElement(s),dl=l!='dataLayer'?'&l='+l:'';j.async=true;j.src= 'https://www.googletagmanager.com/gtm.js?id='+i+dl+ '>m_auth=hzk0Vc3qFsQYhCrIoHz68A>m_preview=env-1>m_cookies_win=x';f.parentNode.insertBefore(j,f); })(window,document,'script','dataLayer','GTM-MWFK8L5J'); ;window.NREUM||(NREUM={});NREUM.init={distributed_tracing:{enabled:true},privacy:{cookies_enabled:true},ajax:{deny_list:[\"bam.nr-data.net\"]}}; ;NREUM.loader_config={accountID:\"438030\",trustKey:\"438030\",agentID:\"772317073\",licenseKey:\"97f8f67f26\",applicationID:\"772317073\"} ;NREUM.info={beacon:\"bam.nr-data.net\",errorBeacon:\"bam.nr-data.net\",licenseKey:\"97f8f67f26\",applicationID:\"772317073\",sa:1} ;/*! For license information please see nr-loader-spa-1.236.0.min.js.LICENSE.txt */ (()=>{\"use strict\";var e,t,r={5763:(e,t,r)=>{r.d(t,{P_:()=>l,Mt:()=>g,C5:()=>s,DL:()=>v,OP:()=>T,lF:()=>D,Yu:()=>y,Dg:()=>h,CX:()=>c,GE:()=>b,sU:()=>_});var n=r(8632),i=r(9567);const o={beacon:n.ce.beacon,errorBeacon:n.ce.errorBeacon,licenseKey:void 0,applicationID:void 0,sa:void 0,queueTime:void 0,applicationTime:void 0,ttGuid:void 0,user:void 0,account:void 0,product:void 0,extra:void 0,jsAttributes:{},userAttributes:void 0,atts:void 0,transactionName:void 0,tNamePlain:void 0},a={};function s(e){if(!e)throw new Error(\"All info objects require an agent identifier!\");if(!a[e])throw new Error(\"Info for \".concat(e,\" was never set\"));return a[e]}function c(e,t){if(!e)throw new Error(\"All info objects require an agent identifier!\");a[e]=(0,i.D)(t,o),(0,n.Qy)(e,a[e],\"info\")}var u=r(7056);const d=()=>{const e={blockSelector:\"[data-nr-block]\",maskInputOptions:{password:!0}};return{allow_bfcache:!0,privacy:{cookies_enabled:!0},ajax:{deny_list:void 0,enabled:!0,harvestTimeSeconds:10},distributed_tracing:{enabled:void 0,exclude_newrelic_header:void 0,cors_use_newrelic_header:void 0,cors_use_tracecontext_headers:void 0,allowed_origins:void 0},session:{domain:void 0,expiresMs:u.oD,inactiveMs:u.Hb},ssl:void 0,obfuscate:void 0,jserrors:{enabled:!0,harvestTimeSeconds:10},metrics:{enabled:!0},page_action:{enabled:!0,harvestTimeSeconds:30},page_view_event:{enabled:!0},page_view_timing:{enabled:!0,harvestTimeSeconds:30,long_task:!1},session_trace:{enabled:!0,harvestTimeSeconds:10},harvest:{tooManyRequestsDelay:60},session_replay:{enabled:!1,harvestTimeSeconds:60,sampleRate:.1,errorSampleRate:.1,maskTextSelector:\"*\",maskAllInputs:!0,get blockClass(){return\"nr-block\"},get ignoreClass(){return\"nr-ignore\"},get maskTextClass(){return\"nr-mask\"},get blockSelector(){return e.blockSelector},set blockSelector(t){e.blockSelector+=\",\".concat(t)},get maskInputOptions(){return e.maskInputOptions},set maskInputOptions(t){e.maskInputOptions={...t,password:!0}}},spa:{enabled:!0,harvestTimeSeconds:10}}},f={};function l(e){if(!e)throw new Error(\"All configuration objects require an agent identifier!\");if(!f[e])throw new Error(\"Configuration for \".concat(e,\" was never set\"));return f[e]}function h(e,t){if(!e)throw new Error(\"All configuration objects require an agent identifier!\");f[e]=(0,i.D)(t,d()),(0,n.Qy)(e,f[e],\"config\")}function g(e,t){if(!e)throw new Error(\"All configuration objects require an agent identifier!\");var r=l(e);if(r){for(var n=t.split(\".\"),i=0;i {r.d(t,{D:()=>i});var n=r(50);function i(e,t){try{if(!e||\"object\"!=typeof e)return(0,n.Z)(\"Setting a Configurable requires an object as input\");if(!t||\"object\"!=typeof t)return(0,n.Z)(\"Setting a Configurable requires a model to set its initial properties\");const r=Object.create(Object.getPrototypeOf(t),Object.getOwnPropertyDescriptors(t)),o=0===Object.keys(r).length?e:r;for(let a in o)if(void 0!==e[a])try{\"object\"==typeof e[a]&&\"object\"==typeof t[a]?r[a]=i(e[a],t[a]):r[a]=e[a]}catch(e){(0,n.Z)(\"An error occurred while setting a property of a Configurable\",e)}return r}catch(e){(0,n.Z)(\"An error occured while setting a Configurable\",e)}}},6818:(e,t,r)=>{r.d(t,{Re:()=>i,gF:()=>o,q4:()=>n});const n=\"1.236.0\",i=\"PROD\",o=\"CDN\"},385:(e,t,r)=>{r.d(t,{FN:()=>a,IF:()=>u,Nk:()=>f,Tt:()=>s,_A:()=>o,il:()=>n,pL:()=>c,v6:()=>i,w1:()=>d});const n=\"undefined\"!=typeof window&&!!window.document,i=\"undefined\"!=typeof WorkerGlobalScope&&(\"undefined\"!=typeof self&&self instanceof WorkerGlobalScope&&self.navigator instanceof WorkerNavigator||\"undefined\"!=typeof globalThis&&globalThis instanceof WorkerGlobalScope&&globalThis.navigator instanceof WorkerNavigator),o=n?window:\"undefined\"!=typeof WorkerGlobalScope&&(\"undefined\"!=typeof self&&self instanceof WorkerGlobalScope&&self||\"undefined\"!=typeof globalThis&&globalThis instanceof WorkerGlobalScope&&globalThis),a=\"\"+o?.location,s=/iPad|iPhone|iPod/.test(navigator.userAgent),c=s&&\"undefined\"==typeof SharedWorker,u=(()=>{const e=navigator.userAgent.match(/Firefox[/\\s](\\d+\\.\\d+)/);return Array.isArray(e)&&e.length>=2?+e[1]:0})(),d=Boolean(n&&window.document.documentMode),f=!!navigator.sendBeacon},1117:(e,t,r)=>{r.d(t,{w:()=>o});var n=r(50);const i={agentIdentifier:\"\",ee:void 0};class o{constructor(e){try{if(\"object\"!=typeof e)return(0,n.Z)(\"shared context requires an object as input\");this.sharedContext={},Object.assign(this.sharedContext,i),Object.entries(e).forEach((e=>{let[t,r]=e;Object.keys(i).includes(t)&&(this.sharedContext[t]=r)}))}catch(e){(0,n.Z)(\"An error occured while setting SharedContext\",e)}}}},8e3:(e,t,r)=>{r.d(t,{L:()=>d,R:()=>c});var n=r(2177),i=r(1284),o=r(4322),a=r(3325);const s={};function c(e,t){const r={staged:!1,priority:a.p[t]||0};u(e),s[e].get(t)||s[e].set(t,r)}function u(e){e&&(s[e]||(s[e]=new Map))}function d(){let e=arguments.length>0&&void 0!==arguments[0]?arguments[0]:\"\",t=arguments.length>1&&void 0!==arguments[1]?arguments[1]:\"feature\";if(u(e),!e||!s[e].get(t))return a(t);s[e].get(t).staged=!0;const r=[...s[e]];function a(t){const r=e?n.ee.get(e):n.ee,a=o.X.handlers;if(r.backlog&&a){var s=r.backlog[t],c=a[t];if(c){for(var u=0;s&&u {let[t,r]=e;return r.staged}))&&(r.sort(((e,t)=>e[1].priority-t[1].priority)),r.forEach((e=>{let[t]=e;a(t)})))}function f(e,t){var r=e[1];(0,i.D)(t[r],(function(t,r){var n=e[0];if(r[0]===n){var i=r[1],o=e[3],a=e[2];i.apply(o,a)}}))}},2177:(e,t,r)=>{r.d(t,{c:()=>f,ee:()=>u});var n=r(8632),i=r(2210),o=r(1284),a=r(5763),s=\"nr@context\";let c=(0,n.fP)();var u;function d(){}function f(e){return(0,i.X)(e,s,l)}function l(){return new d}function h(){u.aborted=!0,u.backlog={}}c.ee?u=c.ee:(u=function e(t,r){var n={},c={},f={},g=!1;try{g=16===r.length&&(0,a.OP)(r).isolatedBacklog}catch(e){}var p={on:b,addEventListener:b,removeEventListener:y,emit:v,get:x,listeners:w,context:m,buffer:A,abort:h,aborted:!1,isBuffering:E,debugId:r,backlog:g?{}:t&&\"object\"==typeof t.backlog?t.backlog:{}};return p;function m(e){return e&&e instanceof d?e:e?(0,i.X)(e,s,l):l()}function v(e,r,n,i,o){if(!1!==o&&(o=!0),!u.aborted||i){t&&o&&t.emit(e,r,n);for(var a=m(n),s=w(e),d=s.length,f=0;f<d;f++)s[f].apply(a,r);var l=T()[c[e]];return l&&l.push([p,e,r,a]),a}}function b(e,t){n[e]=w(e).concat(t)}function y(e,t){var r=n[e];if(r)for(var i=0;i {r.d(t,{E:()=>n,p:()=>i});var n=r(2177).ee.get(\"handle\");function i(e,t,r,i,o){o?(o.buffer([e],i),o.emit(e,t,r)):(n.buffer([e],i),n.emit(e,t,r))}},4322:(e,t,r)=>{r.d(t,{X:()=>o});var n=r(5546);o.on=a;var i=o.handlers={};function o(e,t,r,o){a(o||n.E,i,e,t,r)}function a(e,t,r,i,o){o||(o=\"feature\"),e||(e=n.E);var a=t[o]=t[o]||{};(a[r]=a[r]||[]).push([e,i])}},3239:(e,t,r)=>{r.d(t,{bP:()=>s,iz:()=>c,m$:()=>a});var n=r(385);let i=!1,o=!1;try{const e={get passive(){return i=!0,!1},get signal(){return o=!0,!1}};n._A.addEventListener(\"test\",null,e),n._A.removeEventListener(\"test\",null,e)}catch(e){}function a(e,t){return i||o?{capture:!!e,passive:i,signal:t}:!!e}function s(e,t){let r=arguments.length>2&&void 0!==arguments[2]&&arguments[2],n=arguments.length>3?arguments[3]:void 0;window.addEventListener(e,t,a(r,n))}function c(e,t){let r=arguments.length>2&&void 0!==arguments[2]&&arguments[2],n=arguments.length>3?arguments[3]:void 0;document.addEventListener(e,t,a(r,n))}},4402:(e,t,r)=>{r.d(t,{Ht:()=>u,M:()=>c,Rl:()=>a,ky:()=>s});var n=r(385);const i=\"xxxxxxxx-xxxx-4xxx-yxxx-xxxxxxxxxxxx\";function o(e,t){return e?15&e[t]:16*Math.random()|0}function a(){const e=n._A?.crypto||n._A?.msCrypto;let t,r=0;return e&&e.getRandomValues&&(t=e.getRandomValues(new Uint8Array(31))),i.split(\"\").map((e=>\"x\"===e?o(t,++r).toString(16):\"y\"===e?(3&o()|8).toString(16):e)).join(\"\")}function s(e){const t=n._A?.crypto||n._A?.msCrypto;let r,i=0;t&&t.getRandomValues&&(r=t.getRandomValues(new Uint8Array(31)));const a=[];for(var s=0;s {r.d(t,{Bq:()=>n,Hb:()=>o,oD:()=>i});const n=\"NRBA\",i=144e5,o=18e5},7894:(e,t,r)=>{function n(){return Math.round(performance.now())}r.d(t,{z:()=>n})},7243:(e,t,r)=>{r.d(t,{e:()=>o});var n=r(385),i={};function o(e){if(e in i)return i[e];if(0===(e||\"\").indexOf(\"data:\"))return{protocol:\"data\"};let t;var r=n._A?.location,o={};if(n.il)t=document.createElement(\"a\"),t.href=e;else try{t=new URL(e,r.href)}catch(e){return o}o.port=t.port;var a=t.href.split(\"://\");!o.port&&a[1]&&(o.port=a[1].split(\"/\")[0].split(\"@\").pop().split(\":\")[1]),o.port&&\"0\"!==o.port||(o.port=\"https\"===a[0]?\"443\":\"80\"),o.hostname=t.hostname||r.hostname,o.pathname=t.pathname,o.protocol=a[0],\"/\"!==o.pathname.charAt(0)&&(o.pathname=\"/\"+o.pathname);var s=!t.protocol||\":\"===t.protocol||t.protocol===r.protocol,c=t.hostname===r.hostname&&t.port===r.port;return o.sameOrigin=s&&(!t.hostname||c),\"/\"===o.pathname&&(i[e]=o),o}},50:(e,t,r)=>{function n(e,t){\"function\"==typeof console.warn&&(console.warn(\"New Relic: \".concat(e)),t&&console.warn(t))}r.d(t,{Z:()=>n})},2587:(e,t,r)=>{r.d(t,{N:()=>c,T:()=>u});var n=r(2177),i=r(5546),o=r(8e3),a=r(3325);const s={stn:[a.D.sessionTrace],err:[a.D.jserrors,a.D.metrics],ins:[a.D.pageAction],spa:[a.D.spa],sr:[a.D.sessionReplay,a.D.sessionTrace]};function c(e,t){const r=n.ee.get(t);e&&\"object\"==typeof e&&(Object.entries(e).forEach((e=>{let[t,n]=e;void 0===u[t]&&(s[t]?s[t].forEach((e=>{n?(0,i.p)(\"feat-\"+t,[],void 0,e,r):(0,i.p)(\"block-\"+t,[],void 0,e,r),(0,i.p)(\"rumresp-\"+t,[Boolean(n)],void 0,e,r)})):n&&(0,i.p)(\"feat-\"+t,[],void 0,void 0,r),u[t]=Boolean(n))})),Object.keys(s).forEach((e=>{void 0===u[e]&&(s[e]?.forEach((t=>(0,i.p)(\"rumresp-\"+e,[!1],void 0,t,r))),u[e]=!1)})),(0,o.L)(t,a.D.pageViewEvent))}const u={}},2210:(e,t,r)=>{r.d(t,{X:()=>i});var n=Object.prototype.hasOwnProperty;function i(e,t,r){if(n.call(e,t))return e[t];var i=r();if(Object.defineProperty&&Object.keys)try{return Object.defineProperty(e,t,{value:i,writable:!0,enumerable:!1}),i}catch(e){}return e[t]=i,i}},1284:(e,t,r)=>{r.d(t,{D:()=>n});const n=(e,t)=>Object.entries(e||{}).map((e=>{let[r,n]=e;return t(r,n)}))},4351:(e,t,r)=>{r.d(t,{P:()=>o});var n=r(2177);const i=()=>{const e=new WeakSet;return(t,r)=>{if(\"object\"==typeof r&&null!==r){if(e.has(r))return;e.add(r)}return r}};function o(e){try{return JSON.stringify(e,i())}catch(e){try{n.ee.emit(\"internal-error\",[e])}catch(e){}}}},3960:(e,t,r)=>{r.d(t,{K:()=>a,b:()=>o});var n=r(3239);function i(){return\"undefined\"==typeof document||\"complete\"===document.readyState}function o(e,t){if(i())return e();(0,n.bP)(\"load\",e,t)}function a(e){if(i())return e();(0,n.iz)(\"DOMContentLoaded\",e)}},8632:(e,t,r)=>{r.d(t,{EZ:()=>u,Qy:()=>c,ce:()=>o,fP:()=>a,gG:()=>d,mF:()=>s});var n=r(7894),i=r(385);const o={beacon:\"bam.nr-data.net\",errorBeacon:\"bam.nr-data.net\"};function a(){return i._A.NREUM||(i._A.NREUM={}),void 0===i._A.newrelic&&(i._A.newrelic=i._A.NREUM),i._A.NREUM}function s(){let e=a();return e.o||(e.o={ST:i._A.setTimeout,SI:i._A.setImmediate,CT:i._A.clearTimeout,XHR:i._A.XMLHttpRequest,REQ:i._A.Request,EV:i._A.Event,PR:i._A.Promise,MO:i._A.MutationObserver,FETCH:i._A.fetch}),e}function c(e,t,r){let i=a();const o=i.initializedAgents||{},s=o[e]||{};return Object.keys(s).length||(s.initializedAt={ms:(0,n.z)(),date:new Date}),i.initializedAgents={...o,[e]:{...s,[r]:t}},i}function u(e,t){a()[e]=t}function d(){return function(){let e=a();const t=e.info||{};e.info={beacon:o.beacon,errorBeacon:o.errorBeacon,...t}}(),function(){let e=a();const t=e.init||{};e.init={...t}}(),s(),function(){let e=a();const t=e.loader_config||{};e.loader_config={...t}}(),a()}},7956:(e,t,r)=>{r.d(t,{N:()=>i});var n=r(3239);function i(e){let t=arguments.length>1&&void 0!==arguments[1]&&arguments[1],r=arguments.length>2?arguments[2]:void 0,i=arguments.length>3?arguments[3]:void 0;return void(0,n.iz)(\"visibilitychange\",(function(){if(t)return void(\"hidden\"==document.visibilityState&&e());e(document.visibilityState)}),r,i)}},1214:(e,t,r)=>{r.d(t,{em:()=>v,u5:()=>N,QU:()=>S,_L:()=>I,Gm:()=>L,Lg:()=>M,gy:()=>U,BV:()=>Q,Kf:()=>ee});var n=r(2177);const i=\"nr@original\";var o=Object.prototype.hasOwnProperty,a=!1;function s(e,t){return e||(e=n.ee),r.inPlace=function(e,t,n,i,o){n||(n=\"\");var a,s,c,u=\"-\"===n.charAt(0);for(c=0;c 2?n-2:0),o=2;o {r(A[T],e,w),r(E[T],e,w)})),r(l._A,\"fetch\",y),t.on(y+\"end\",(function(e,r){var n=this;if(r){var i=r.headers.get(\"content-length\");null!==i&&(n.rxSize=i),t.emit(y+\"done\",[null,r],n)}else t.emit(y+\"done\",[e],n)})),t}const O={},j=[\"pushState\",\"replaceState\"];function S(e){const t=function(e){return(e||n.ee).get(\"history\")}(e);return!l.il||O[t.debugId]++||(O[t.debugId]=1,s(t).inPlace(window.history,j,\"-\")),t}var P=r(3239);const C={},R=[\"appendChild\",\"insertBefore\",\"replaceChild\"];function I(e){const t=function(e){return(e||n.ee).get(\"jsonp\")}(e);if(!l.il||C[t.debugId])return t;C[t.debugId]=!0;var r=s(t),i=/[?&](?:callback|cb)=([^&#]+)/,o=/(.*)\\.([^.]+)/,a=/^(\\w+)(\\.|$)(.*)$/;function c(e,t){var r=e.match(a),n=r[1],i=r[3];return i?c(i,t[n]):t[n]}return r.inPlace(Node.prototype,R,\"dom-\"),t.on(\"dom-start\",(function(e){!function(e){if(!e||\"string\"!=typeof e.nodeName||\"script\"!==e.nodeName.toLowerCase())return;if(\"function\"!=typeof e.addEventListener)return;var n=(a=e.src,s=a.match(i),s?s[1]:null);var a,s;if(!n)return;var u=function(e){var t=e.match(o);if(t&&t.length>=3)return{key:t[2],parent:c(t[1],window)};return{key:e,parent:window}}(n);if(\"function\"!=typeof u.parent[u.key])return;var d={};function f(){t.emit(\"jsonp-end\",[],d),e.removeEventListener(\"load\",f,(0,P.m$)(!1)),e.removeEventListener(\"error\",l,(0,P.m$)(!1))}function l(){t.emit(\"jsonp-error\",[],d),t.emit(\"jsonp-end\",[],d),e.removeEventListener(\"load\",f,(0,P.m$)(!1)),e.removeEventListener(\"error\",l,(0,P.m$)(!1))}r.inPlace(u.parent,[u.key],\"cb-\",d),e.addEventListener(\"load\",f,(0,P.m$)(!1)),e.addEventListener(\"error\",l,(0,P.m$)(!1)),t.emit(\"new-jsonp\",[e.src],d)}(e[0])})),t}var k=r(5763);const H={};function L(e){const t=function(e){return(e||n.ee).get(\"mutation\")}(e);if(!l.il||H[t.debugId])return t;H[t.debugId]=!0;var r=s(t),i=k.Yu.MO;return i&&(window.MutationObserver=function(e){return this instanceof i?new i(r(e,\"fn-\")):i.apply(this,arguments)},MutationObserver.prototype=i.prototype),t}const z={};function M(e){const t=function(e){return(e||n.ee).get(\"promise\")}(e);if(z[t.debugId])return t;z[t.debugId]=!0;var r=n.c,o=s(t),a=k.Yu.PR;return a&&function(){function e(r){var n=t.context(),i=o(r,\"executor-\",n,null,!1);const s=Reflect.construct(a,[i],e);return t.context(s).getCtx=function(){return n},s}l._A.Promise=e,Object.defineProperty(e,\"name\",{value:\"Promise\"}),e.toString=function(){return a.toString()},Object.setPrototypeOf(e,a),[\"all\",\"race\"].forEach((function(r){const n=a[r];e[r]=function(e){let i=!1;[...e||[]].forEach((e=>{this.resolve(e).then(a(\"all\"===r),a(!1))}));const o=n.apply(this,arguments);return o;function a(e){return function(){t.emit(\"propagate\",[null,!i],o,!1,!1),i=i||!e}}}})),[\"resolve\",\"reject\"].forEach((function(r){const n=a[r];e[r]=function(e){const r=n.apply(this,arguments);return e!==r&&t.emit(\"propagate\",[e,!0],r,!1,!1),r}})),e.prototype=a.prototype;const n=a.prototype.then;a.prototype.then=function(){var e=this,i=r(e);i.promise=e;for(var a=arguments.length,s=new Array(a),c=0;c e())),t};function m(e,t){i.inPlace(t,[\"onreadystatechange\"],\"fn-\",E)}function b(){var e=this,t=r.context(e);e.readyState>3&&!t.resolved&&(t.resolved=!0,r.emit(\"xhr-resolved\",[],e)),i.inPlace(e,f,\"fn-\",E)}if(function(e,t){for(var r in e)t[r]=e[r]}(o,p),p.prototype=o.prototype,i.inPlace(p.prototype,J,\"-xhr-\",E),r.on(\"send-xhr-start\",(function(e,t){m(e,t),function(e){h.push(e),a&&(y?y.then(A):u?u(A):(w=-w,x.data=w))}(t)})),r.on(\"open-xhr-start\",m),a){var y=c&&c.resolve();if(!u&&!c){var w=1,x=document.createTextNode(w);new a(A).observe(x,{characterData:!0})}}else t.on(\"fn-end\",(function(e){e[0]&&e[0].type===d||A()}));function A(){for(var e=0;e {r.d(t,{t:()=>n});const n=r(3325).D.ajax},6660:(e,t,r)=>{r.d(t,{A:()=>i,t:()=>n});const n=r(3325).D.jserrors,i=\"nr@seenError\"},3081:(e,t,r)=>{r.d(t,{gF:()=>o,mY:()=>i,t9:()=>n,vz:()=>s,xS:()=>a});const n=r(3325).D.metrics,i=\"sm\",o=\"cm\",a=\"storeSupportabilityMetrics\",s=\"storeEventMetrics\"},4649:(e,t,r)=>{r.d(t,{t:()=>n});const n=r(3325).D.pageAction},7633:(e,t,r)=>{r.d(t,{Dz:()=>i,OJ:()=>a,qw:()=>o,t9:()=>n});const n=r(3325).D.pageViewEvent,i=\"firstbyte\",o=\"domcontent\",a=\"windowload\"},9251:(e,t,r)=>{r.d(t,{t:()=>n});const n=r(3325).D.pageViewTiming},3614:(e,t,r)=>{r.d(t,{BST_RESOURCE:()=>i,END:()=>s,FEATURE_NAME:()=>n,FN_END:()=>u,FN_START:()=>c,PUSH_STATE:()=>d,RESOURCE:()=>o,START:()=>a});const n=r(3325).D.sessionTrace,i=\"bstResource\",o=\"resource\",a=\"-start\",s=\"-end\",c=\"fn\"+a,u=\"fn\"+s,d=\"pushState\"},7836:(e,t,r)=>{r.d(t,{BODY:()=>A,CB_END:()=>E,CB_START:()=>u,END:()=>x,FEATURE_NAME:()=>i,FETCH:()=>_,FETCH_BODY:()=>v,FETCH_DONE:()=>m,FETCH_START:()=>p,FN_END:()=>c,FN_START:()=>s,INTERACTION:()=>l,INTERACTION_API:()=>d,INTERACTION_EVENTS:()=>o,JSONP_END:()=>b,JSONP_NODE:()=>g,JS_TIME:()=>T,MAX_TIMER_BUDGET:()=>a,REMAINING:()=>f,SPA_NODE:()=>h,START:()=>w,originalSetTimeout:()=>y});var n=r(5763);const i=r(3325).D.spa,o=[\"click\",\"submit\",\"keypress\",\"keydown\",\"keyup\",\"change\"],a=999,s=\"fn-start\",c=\"fn-end\",u=\"cb-start\",d=\"api-ixn-\",f=\"remaining\",l=\"interaction\",h=\"spaNode\",g=\"jsonpNode\",p=\"fetch-start\",m=\"fetch-done\",v=\"fetch-body-\",b=\"jsonp-end\",y=n.Yu.ST,w=\"-start\",x=\"-end\",A=\"-body\",E=\"cb\"+x,T=\"jsTime\",_=\"fetch\"},5938:(e,t,r)=>{r.d(t,{W:()=>o});var n=r(5763),i=r(2177);class o{constructor(e,t,r){this.agentIdentifier=e,this.aggregator=t,this.ee=i.ee.get(e,(0,n.OP)(this.agentIdentifier).isolatedBacklog),this.featureName=r,this.blocked=!1}}},9144:(e,t,r)=>{r.d(t,{j:()=>m});var n=r(3325),i=r(5763),o=r(5546),a=r(2177),s=r(7894),c=r(8e3),u=r(3960),d=r(385),f=r(50),l=r(3081),h=r(8632);function g(){const e=(0,h.gG)();[\"setErrorHandler\",\"finished\",\"addToTrace\",\"inlineHit\",\"addRelease\",\"addPageAction\",\"setCurrentRouteName\",\"setPageViewName\",\"setCustomAttribute\",\"interaction\",\"noticeError\",\"setUserId\"].forEach((t=>{e[t]=function(){for(var r=arguments.length,n=new Array(r),i=0;i 1?r-1:0),i=1;i {e.exposed&&e.api[t]&&o.push(e.api[t](...n))})),o.length>1?o:o[0]}(t,...n)}}))}var p=r(2587);function m(e){let t=arguments.length>1&&void 0!==arguments[1]?arguments[1]:{},m=arguments.length>2?arguments[2]:void 0,v=arguments.length>3?arguments[3]:void 0,{init:b,info:y,loader_config:w,runtime:x={loaderType:m},exposed:A=!0}=t;const E=(0,h.gG)();y||(b=E.init,y=E.info,w=E.loader_config),(0,i.Dg)(e,b||{}),(0,i.GE)(e,w||{}),(0,i.sU)(e,x),y.jsAttributes??={},d.v6&&(y.jsAttributes.isWorker=!0),(0,i.CX)(e,y),g();const T=function(e,t){t||(0,c.R)(e,\"api\");const h={};var g=a.ee.get(e),p=g.get(\"tracer\"),m=\"api-\",v=m+\"ixn-\";function b(t,r,n,o){const a=(0,i.C5)(e);return null===r?delete a.jsAttributes[t]:(0,i.CX)(e,{...a,jsAttributes:{...a.jsAttributes,[t]:r}}),x(m,n,!0,o||null===r?\"session\":void 0)(t,r)}function y(){}[\"setErrorHandler\",\"finished\",\"addToTrace\",\"inlineHit\",\"addRelease\"].forEach((e=>h[e]=x(m,e,!0,\"api\"))),h.addPageAction=x(m,\"addPageAction\",!0,n.D.pageAction),h.setCurrentRouteName=x(m,\"routeName\",!0,n.D.spa),h.setPageViewName=function(t,r){if(\"string\"==typeof t)return\"/\"!==t.charAt(0)&&(t=\"/\"+t),(0,i.OP)(e).customTransaction=(r||\"http://custom.transaction\")+t,x(m,\"setPageViewName\",!0)()},h.setCustomAttribute=function(e,t){let r=arguments.length>2&&void 0!==arguments[2]&&arguments[2];if(\"string\"==typeof e){if([\"string\",\"number\"].includes(typeof t)||null===t)return b(e,t,\"setCustomAttribute\",r);(0,f.Z)(\"Failed to execute setCustomAttribute.\\nNon-null value must be a string or number type, but a type of was provided.\"))}else(0,f.Z)(\"Failed to execute setCustomAttribute.\\nName must be a string type, but a type of was provided.\"))},h.setUserId=function(e){if(\"string\"==typeof e||null===e)return b(\"enduser.id\",e,\"setUserId\",!0);(0,f.Z)(\"Failed to execute setUserId.\\nNon-null value must be a string type, but a type of was provided.\"))},h.interaction=function(){return(new y).get()};var w=y.prototype={createTracer:function(e,t){var r={},i=this,a=\"function\"==typeof t;return(0,o.p)(v+\"tracer\",[(0,s.z)(),e,r],i,n.D.spa,g),function(){if(p.emit((a?\"\":\"no-\")+\"fn-start\",[(0,s.z)(),i,a],r),a)try{return t.apply(this,arguments)}catch(e){throw p.emit(\"fn-err\",[arguments,this,\"string\"==typeof e?new Error(e):e],r),e}finally{p.emit(\"fn-end\",[(0,s.z)()],r)}}}};function x(e,t,r,i){return function(){return(0,o.p)(l.xS,[\"API/\"+t+\"/called\"],void 0,n.D.metrics,g),i&&(0,o.p)(e+t,[(0,s.z)(),...arguments],r?null:this,i,g),r?void 0:this}}function A(){r.e(439).then(r.bind(r,7438)).then((t=>{let{setAPI:r}=t;r(e),(0,c.L)(e,\"api\")})).catch((()=>(0,f.Z)(\"Downloading runtime APIs failed...\")))}return[\"actionText\",\"setName\",\"setAttribute\",\"save\",\"ignore\",\"onEnd\",\"getContext\",\"end\",\"get\"].forEach((e=>{w[e]=x(v,e,void 0,n.D.spa)})),h.noticeError=function(e,t){\"string\"==typeof e&&(e=new Error(e)),(0,o.p)(l.xS,[\"API/noticeError/called\"],void 0,n.D.metrics,g),(0,o.p)(\"err\",[e,(0,s.z)(),!1,t],void 0,n.D.jserrors,g)},d.il?(0,u.b)((()=>A()),!0):A(),h}(e,v);return(0,h.Qy)(e,T,\"api\"),(0,h.Qy)(e,A,\"exposed\"),(0,h.EZ)(\"activatedFeatures\",p.T),T}},3325:(e,t,r)=>{r.d(t,{D:()=>n,p:()=>i});const n={ajax:\"ajax\",jserrors:\"jserrors\",metrics:\"metrics\",pageAction:\"page_action\",pageViewEvent:\"page_view_event\",pageViewTiming:\"page_view_timing\",sessionReplay:\"session_replay\",sessionTrace:\"session_trace\",spa:\"spa\"},i={[n.pageViewEvent]:1,[n.pageViewTiming]:2,[n.metrics]:3,[n.jserrors]:4,[n.ajax]:5,[n.sessionTrace]:6,[n.pageAction]:7,[n.spa]:8,[n.sessionReplay]:9}}},n={};function i(e){var t=n[e];if(void 0!==t)return t.exports;var o=n[e]={exports:{}};return r[e](o,o.exports,i),o.exports}i.m=r,i.d=(e,t)=>{for(var r in t)i.o(t,r)&&!i.o(e,r)&&Object.defineProperty(e,r,{enumerable:!0,get:t[r]})},i.f={},i.e=e=>Promise.all(Object.keys(i.f).reduce(((t,r)=>(i.f[r](e,t),t)),[])),i.u=e=>(({78:\"page_action-aggregate\",147:\"metrics-aggregate\",242:\"session-manager\",317:\"jserrors-aggregate\",348:\"page_view_timing-aggregate\",412:\"lazy-feature-loader\",439:\"async-api\",538:\"recorder\",590:\"session_replay-aggregate\",675:\"compressor\",733:\"session_trace-aggregate\",786:\"page_view_event-aggregate\",873:\"spa-aggregate\",898:\"ajax-aggregate\"}[e]||e)+\".\"+{78:\"ac76d497\",147:\"3dc53903\",148:\"1a20d5fe\",242:\"2a64278a\",317:\"49e41428\",348:\"bd6de33a\",412:\"2f55ce66\",439:\"30bd804e\",538:\"1b18459f\",590:\"cf0efb30\",675:\"ae9f91a8\",733:\"83105561\",786:\"06482edd\",860:\"03a8b7a5\",873:\"e6b09d52\",898:\"998ef92b\"}[e]+\"-1.236.0.min.js\"),i.o=(e,t)=>Object.prototype.hasOwnProperty.call(e,t),e={},t=\"NRBA:\",i.l=(r,n,o,a)=>{if(e[r])e[r].push(n);else{var s,c;if(void 0!==o)for(var u=document.getElementsByTagName(\"script\"),d=0;d {s.onerror=s.onload=null,clearTimeout(h);var i=e[r];if(delete e[r],s.parentNode&&s.parentNode.removeChild(s),i&&i.forEach((e=>e(n))),t)return t(n)},h=setTimeout(l.bind(null,void 0,{type:\"timeout\",target:s}),12e4);s.onerror=l.bind(null,s.onerror),s.onload=l.bind(null,s.onload),c&&document.head.appendChild(s)}},i.r=e=>{\"undefined\"!=typeof Symbol&&Symbol.toStringTag&&Object.defineProperty(e,Symbol.toStringTag,{value:\"Module\"}),Object.defineProperty(e,\"__esModule\",{value:!0})},i.j=364,i.p=\"https://js-agent.newrelic.com/\",(()=>{var e={364:0,953:0};i.f.j=(t,r)=>{var n=i.o(e,t)?e[t]:void 0;if(0!==n)if(n)r.push(n[2]);else{var o=new Promise(((r,i)=>n=e[t]=[r,i]));r.push(n[2]=o);var a=i.p+i.u(t),s=new Error;i.l(a,(r=>{if(i.o(e,t)&&(0!==(n=e[t])&&(e[t]=void 0),n)){var o=r&&(\"load\"===r.type?\"missing\":r.type),a=r&&r.target&&r.target.src;s.message=\"Loading chunk \"+t+\" failed.\\n(\"+o+\": \"+a+\")\",s.name=\"ChunkLoadError\",s.type=o,s.request=a,n[1](s)}}),\"chunk-\"+t,t)}};var t=(t,r)=>{var n,o,[a,s,c]=r,u=0;if(a.some((t=>0!==e[t]))){for(n in s)i.o(s,n)&&(i.m[n]=s[n]);if(c)c(i)}for(t&&t(r);u {i.r(o);var e=i(3325),t=i(5763);const r=Object.values(e.D);function n(e){const n={};return r.forEach((r=>{n[r]=function(e,r){return!1!==(0,t.Mt)(r,\"\".concat(e,\".enabled\"))}(r,e)})),n}var a=i(9144);var s=i(5546),c=i(385),u=i(8e3),d=i(5938),f=i(3960),l=i(50);class h extends d.W{constructor(e,t,r){let n=!(arguments.length>3&&void 0!==arguments[3])||arguments[3];super(e,t,r),this.auto=n,this.abortHandler,this.featAggregate,this.onAggregateImported,n&&(0,u.R)(e,r)}importAggregator(){let e=arguments.length>0&&void 0!==arguments[0]?arguments[0]:{};if(this.featAggregate||!this.auto)return;const r=c.il&&!0===(0,t.Mt)(this.agentIdentifier,\"privacy.cookies_enabled\");let n;this.onAggregateImported=new Promise((e=>{n=e}));const o=async()=>{let t;try{if(r){const{setupAgentSession:e}=await Promise.all([i.e(860),i.e(242)]).then(i.bind(i,3228));t=e(this.agentIdentifier)}}catch(e){(0,l.Z)(\"A problem occurred when starting up session manager. This page will not start or extend any session.\",e)}try{if(!this.shouldImportAgg(this.featureName,t))return void(0,u.L)(this.agentIdentifier,this.featureName);const{lazyFeatureLoader:r}=await i.e(412).then(i.bind(i,8582)),{Aggregate:o}=await r(this.featureName,\"aggregate\");this.featAggregate=new o(this.agentIdentifier,this.aggregator,e),n(!0)}catch(e){(0,l.Z)(\"Downloading and initializing \".concat(this.featureName,\" failed...\"),e),this.abortHandler?.(),n(!1)}};c.il?(0,f.b)((()=>o()),!0):o()}shouldImportAgg(r,n){return r!==e.D.sessionReplay||!1!==(0,t.Mt)(this.agentIdentifier,\"session_trace.enabled\")&&(!!n?.isNew||!!n?.state.sessionReplay)}}var g=i(7633),p=i(7894);class m extends h{static featureName=g.t9;constructor(r,n){let i=!(arguments.length>2&&void 0!==arguments[2])||arguments[2];if(super(r,n,g.t9,i),(\"undefined\"==typeof PerformanceNavigationTiming||c.Tt)&&\"undefined\"!=typeof PerformanceTiming){const n=(0,t.OP)(r);n[g.Dz]=Math.max(Date.now()-n.offset,0),(0,f.K)((()=>n[g.qw]=Math.max((0,p.z)()-n[g.Dz],0))),(0,f.b)((()=>{const t=(0,p.z)();n[g.OJ]=Math.max(t-n[g.Dz],0),(0,s.p)(\"timing\",[\"load\",t],void 0,e.D.pageViewTiming,this.ee)}))}this.importAggregator()}}var v=i(1117),b=i(1284);class y extends v.w{constructor(e){super(e),this.aggregatedData={}}store(e,t,r,n,i){var o=this.getBucket(e,t,r,i);return o.metrics=function(e,t){t||(t={count:0});return t.count+=1,(0,b.D)(e,(function(e,r){t[e]=w(r,t[e])})),t}(n,o.metrics),o}merge(e,t,r,n,i){var o=this.getBucket(e,t,n,i);if(o.metrics){var a=o.metrics;a.count+=r.count,(0,b.D)(r,(function(e,t){if(\"count\"!==e){var n=a[e],i=r[e];i&&!i.c?a[e]=w(i.t,n):a[e]=function(e,t){if(!t)return e;t.c||(t=x(t.t));return t.min=Math.min(e.min,t.min),t.max=Math.max(e.max,t.max),t.t+=e.t,t.sos+=e.sos,t.c+=e.c,t}(i,a[e])}}))}else o.metrics=r}storeMetric(e,t,r,n){var i=this.getBucket(e,t,r);return i.stats=w(n,i.stats),i}getBucket(e,t,r,n){this.aggregatedData[e]||(this.aggregatedData[e]={});var i=this.aggregatedData[e][t];return i||(i=this.aggregatedData[e][t]={params:r||{}},n&&(i.custom=n)),i}get(e,t){return t?this.aggregatedData[e]&&this.aggregatedData[e][t]:this.aggregatedData[e]}take(e){for(var t={},r=\"\",n=!1,i=0;i t.max&&(t.max=e),e 2&&void 0!==arguments[2])||arguments[2];super(e,r,j.t,n),c.il&&((0,t.OP)(e).initHidden=Boolean(\"hidden\"===document.visibilityState),(0,N.N)((()=>(0,s.p)(\"docHidden\",[(0,p.z)()],void 0,j.t,this.ee)),!0),(0,O.bP)(\"pagehide\",(()=>(0,s.p)(\"winPagehide\",[(0,p.z)()],void 0,j.t,this.ee))),this.importAggregator())}}var P=i(3081);class C extends h{static featureName=P.t9;constructor(e,t){let r=!(arguments.length>2&&void 0!==arguments[2])||arguments[2];super(e,t,P.t9,r),this.importAggregator()}}var R,I=i(2210),k=i(1214),H=i(2177),L={};try{R=localStorage.getItem(\"__nr_flags\").split(\",\"),console&&\"function\"==typeof console.log&&(L.console=!0,-1!==R.indexOf(\"dev\")&&(L.dev=!0),-1!==R.indexOf(\"nr_dev\")&&(L.nrDev=!0))}catch(e){}function z(e){try{L.console&&z(e)}catch(e){}}L.nrDev&&H.ee.on(\"internal-error\",(function(e){z(e.stack)})),L.dev&&H.ee.on(\"fn-err\",(function(e,t,r){z(r.stack)})),L.dev&&(z(\"NR AGENT IN DEVELOPMENT MODE\"),z(\"flags: \"+(0,b.D)(L,(function(e,t){return e})).join(\", \")));var M=i(6660);class B extends h{static featureName=M.t;constructor(r,n){let i=!(arguments.length>2&&void 0!==arguments[2])||arguments[2];super(r,n,M.t,i),this.skipNext=0;try{this.removeOnAbort=new AbortController}catch(e){}const o=this;o.ee.on(\"fn-start\",(function(e,t,r){o.abortHandler&&(o.skipNext+=1)})),o.ee.on(\"fn-err\",(function(t,r,n){o.abortHandler&&!n[M.A]&&((0,I.X)(n,M.A,(function(){return!0})),this.thrown=!0,(0,s.p)(\"err\",[n,(0,p.z)()],void 0,e.D.jserrors,o.ee))})),o.ee.on(\"fn-end\",(function(){o.abortHandler&&!this.thrown&&o.skipNext>0&&(o.skipNext-=1)})),o.ee.on(\"internal-error\",(function(t){(0,s.p)(\"ierr\",[t,(0,p.z)(),!0],void 0,e.D.jserrors,o.ee)})),this.origOnerror=c._A.onerror,c._A.onerror=this.onerrorHandler.bind(this),c._A.addEventListener(\"unhandledrejection\",(t=>{const r=function(e){let t=\"Unhandled Promise Rejection: \";if(e instanceof Error)try{return e.message=t+e.message,e}catch(t){return e}if(void 0===e)return new Error(t);try{return new Error(t+(0,D.P)(e))}catch(e){return new Error(t)}}(t.reason);(0,s.p)(\"err\",[r,(0,p.z)(),!1,{unhandledPromiseRejection:1}],void 0,e.D.jserrors,this.ee)}),(0,O.m$)(!1,this.removeOnAbort?.signal)),(0,k.gy)(this.ee),(0,k.BV)(this.ee),(0,k.em)(this.ee),(0,t.OP)(r).xhrWrappable&&(0,k.Kf)(this.ee),this.abortHandler=this.#e,this.importAggregator()}#e(){this.removeOnAbort?.abort(),this.abortHandler=void 0}onerrorHandler(t,r,n,i,o){\"function\"==typeof this.origOnerror&&this.origOnerror(...arguments);try{this.skipNext?this.skipNext-=1:(0,s.p)(\"err\",[o||new F(t,r,n),(0,p.z)()],void 0,e.D.jserrors,this.ee)}catch(t){try{(0,s.p)(\"ierr\",[t,(0,p.z)(),!0],void 0,e.D.jserrors,this.ee)}catch(e){}}return!1}}function F(e,t,r){this.message=e||\"Uncaught error with no additional information\",this.sourceURL=t,this.line=r}let U=1;const q=\"nr@id\";function G(e){const t=typeof e;return!e||\"object\"!==t&&\"function\"!==t?-1:e===c._A?0:(0,I.X)(e,q,(function(){return U++}))}function V(e){if(\"string\"==typeof e&&e.length)return e.length;if(\"object\"==typeof e){if(\"undefined\"!=typeof ArrayBuffer&&e instanceof ArrayBuffer&&e.byteLength)return e.byteLength;if(\"undefined\"!=typeof Blob&&e instanceof Blob&&e.size)return e.size;if(!(\"undefined\"!=typeof FormData&&e instanceof FormData))try{return(0,D.P)(e).length}catch(e){return}}}var X=i(7243);class W{constructor(e){this.agentIdentifier=e,this.generateTracePayload=this.generateTracePayload.bind(this),this.shouldGenerateTrace=this.shouldGenerateTrace.bind(this)}generateTracePayload(e){if(!this.shouldGenerateTrace(e))return null;var r=(0,t.DL)(this.agentIdentifier);if(!r)return null;var n=(r.accountID||\"\").toString()||null,i=(r.agentID||\"\").toString()||null,o=(r.trustKey||\"\").toString()||null;if(!n||!i)return null;var a=(0,_.M)(),s=(0,_.Ht)(),c=Date.now(),u={spanId:a,traceId:s,timestamp:c};return(e.sameOrigin||this.isAllowedOrigin(e)&&this.useTraceContextHeadersForCors())&&(u.traceContextParentHeader=this.generateTraceContextParentHeader(a,s),u.traceContextStateHeader=this.generateTraceContextStateHeader(a,c,n,i,o)),(e.sameOrigin&&!this.excludeNewrelicHeader()||!e.sameOrigin&&this.isAllowedOrigin(e)&&this.useNewrelicHeaderForCors())&&(u.newrelicHeader=this.generateTraceHeader(a,s,c,n,i,o)),u}generateTraceContextParentHeader(e,t){return\"00-\"+t+\"-\"+e+\"-01\"}generateTraceContextStateHeader(e,t,r,n,i){return i+\"@nr=0-1-\"+r+\"-\"+n+\"-\"+e+\"----\"+t}generateTraceHeader(e,t,r,n,i,o){if(!(\"function\"==typeof c._A?.btoa))return null;var a={v:[0,1],d:{ty:\"Browser\",ac:n,ap:i,id:e,tr:t,ti:r}};return o&&n!==o&&(a.d.tk=o),btoa((0,D.P)(a))}shouldGenerateTrace(e){return this.isDtEnabled()&&this.isAllowedOrigin(e)}isAllowedOrigin(e){var r=!1,n={};if((0,t.Mt)(this.agentIdentifier,\"distributed_tracing\")&&(n=(0,t.P_)(this.agentIdentifier).distributed_tracing),e.sameOrigin)r=!0;else if(n.allowed_origins instanceof Array)for(var i=0;i 2&&void 0!==arguments[2])||arguments[2];super(r,n,Z.t,i),(0,t.OP)(r).xhrWrappable&&(this.dt=new W(r),this.handler=(e,t,r,n)=>(0,s.p)(e,t,r,n,this.ee),(0,k.u5)(this.ee),(0,k.Kf)(this.ee),function(r,n,i,o){function a(e){var t=this;t.totalCbs=0,t.called=0,t.cbTime=0,t.end=E,t.ended=!1,t.xhrGuids={},t.lastSize=null,t.loadCaptureCalled=!1,t.params=this.params||{},t.metrics=this.metrics||{},e.addEventListener(\"load\",(function(r){_(t,e)}),(0,O.m$)(!1)),c.IF||e.addEventListener(\"progress\",(function(e){t.lastSize=e.loaded}),(0,O.m$)(!1))}function s(e){this.params={method:e[0]},T(this,e[1]),this.metrics={}}function u(e,n){var i=(0,t.DL)(r);i.xpid&&this.sameOrigin&&n.setRequestHeader(\"X-NewRelic-ID\",i.xpid);var a=o.generateTracePayload(this.parsedOrigin);if(a){var s=!1;a.newrelicHeader&&(n.setRequestHeader(\"newrelic\",a.newrelicHeader),s=!0),a.traceContextParentHeader&&(n.setRequestHeader(\"traceparent\",a.traceContextParentHeader),a.traceContextStateHeader&&n.setRequestHeader(\"tracestate\",a.traceContextStateHeader),s=!0),s&&(this.dt=a)}}function d(e,t){var r=this.metrics,i=e[0],o=this;if(r&&i){var a=V(i);a&&(r.txSize=a)}this.startTime=(0,p.z)(),this.listener=function(e){try{\"abort\"!==e.type||o.loadCaptureCalled||(o.params.aborted=!0),(\"load\"!==e.type||o.called===o.totalCbs&&(o.onloadCalled||\"function\"!=typeof t.onload)&&\"function\"==typeof o.end)&&o.end(t)}catch(e){try{n.emit(\"internal-error\",[e])}catch(e){}}};for(var s=0;s 1?e[1]=i:e.push(i)}else e[0]&&e[0].headers&&s(e[0].headers,n)&&(this.dt=n);function s(e,t){var r=!1;return t.newrelicHeader&&(e.set(\"newrelic\",t.newrelicHeader),r=!0),t.traceContextParentHeader&&(e.set(\"traceparent\",t.traceContextParentHeader),t.traceContextStateHeader&&e.set(\"tracestate\",t.traceContextStateHeader),r=!0),r}}function x(e,t){this.params={},this.metrics={},this.startTime=(0,p.z)(),this.dt=t,e.length>=1&&(this.target=e[0]),e.length>=2&&(this.opts=e[1]);var r,n=this.opts||{},i=this.target;\"string\"==typeof i?r=i:\"object\"==typeof i&&i instanceof Y?r=i.url:c._A?.URL&&\"object\"==typeof i&&i instanceof URL&&(r=i.href),T(this,r);var o=(\"\"+(i&&i instanceof Y&&i.method||n.method||\"GET\")).toUpperCase();this.params.method=o,this.txSize=V(n.body)||0}function A(t,r){var n;this.endTime=(0,p.z)(),this.params||(this.params={}),this.params.status=r?r.status:0,\"string\"==typeof this.rxSize&&this.rxSize.length>0&&(n=+this.rxSize);var o={txSize:this.txSize,rxSize:n,duration:(0,p.z)()-this.startTime};i(\"xhr\",[this.params,o,this.startTime,this.endTime,\"fetch\"],this,e.D.ajax)}function E(t){var r=this.params,n=this.metrics;if(!this.ended){this.ended=!0;for(var o=0;o 2&&void 0!==arguments[2])||arguments[2];super(e,t,we.t,r),this.importAggregator()}}new class{constructor(e){let t=arguments.length>1&&void 0!==arguments[1]?arguments[1]:(0,_.ky)(16);c._A?(this.agentIdentifier=t,this.sharedAggregator=new y({agentIdentifier:this.agentIdentifier}),this.features={},this.desiredFeatures=new Set(e.features||[]),this.desiredFeatures.add(m),Object.assign(this,(0,a.j)(this.agentIdentifier,e,e.loaderType||\"agent\")),this.start()):(0,l.Z)(\"Failed to initial the agent. Could not determine the runtime environment.\")}get config(){return{info:(0,t.C5)(this.agentIdentifier),init:(0,t.P_)(this.agentIdentifier),loader_config:(0,t.DL)(this.agentIdentifier),runtime:(0,t.OP)(this.agentIdentifier)}}start(){const t=\"features\";try{const r=n(this.agentIdentifier),i=[...this.desiredFeatures];i.sort(((t,r)=>e.p[t.featureName]-e.p[r.featureName])),i.forEach((t=>{if(r[t.featureName]||t.featureName===e.D.pageViewEvent){const n=function(t){switch(t){case e.D.ajax:return[e.D.jserrors];case e.D.sessionTrace:return[e.D.ajax,e.D.pageViewEvent];case e.D.sessionReplay:return[e.D.sessionTrace];case e.D.pageViewTiming:return[e.D.pageViewEvent];default:return[]}}(t.featureName);n.every((e=>r[e]))||(0,l.Z)(\"\".concat(t.featureName,\" is enabled but one or more dependent features has been disabled (\").concat((0,D.P)(n),\"). This may cause unintended consequences or missing data...\")),this.features[t.featureName]=new t(this.agentIdentifier,this.sharedAggregator)}})),(0,T.Qy)(this.agentIdentifier,this.features,t)}catch(e){(0,l.Z)(\"Failed to initialize all enabled instrument classes (agent aborted) -\",e);for(const e in this.features)this.features[e].abortHandler?.();const r=(0,T.fP)();return delete r.initializedAgents[this.agentIdentifier]?.api,delete r.initializedAgents[this.agentIdentifier]?.[t],delete this.sharedAggregator,r.ee?.abort(),delete r.ee?.get(this.agentIdentifier),!1}}}({features:[J,m,S,class extends h{static featureName=oe;constructor(t,r){if(super(t,r,oe,!(arguments.length>2&&void 0!==arguments[2])||arguments[2]),!c.il)return;const n=this.ee;let i;(0,k.QU)(n),this.eventsEE=(0,k.em)(n),this.eventsEE.on(se,(function(e,t){this.bstStart=(0,p.z)()})),this.eventsEE.on(ae,(function(t,r){(0,s.p)(\"bst\",[t[0],r,this.bstStart,(0,p.z)()],void 0,e.D.sessionTrace,n)})),n.on(ce+ne,(function(e){this.time=(0,p.z)(),this.startPath=location.pathname+location.hash})),n.on(ce+ie,(function(t){(0,s.p)(\"bstHist\",[location.pathname+location.hash,this.startPath,this.time],void 0,e.D.sessionTrace,n)}));try{i=new PerformanceObserver((t=>{const r=t.getEntries();(0,s.p)(te,[r],void 0,e.D.sessionTrace,n)})),i.observe({type:re,buffered:!0})}catch(e){}this.importAggregator({resourceObserver:i})}},C,xe,B,class extends h{static featureName=de;constructor(e,r){if(super(e,r,de,!(arguments.length>2&&void 0!==arguments[2])||arguments[2]),!c.il)return;if(!(0,t.OP)(e).xhrWrappable)return;try{this.removeOnAbort=new AbortController}catch(e){}let n,i=0;const o=this.ee.get(\"tracer\"),a=(0,k._L)(this.ee),s=(0,k.Lg)(this.ee),u=(0,k.BV)(this.ee),d=(0,k.Kf)(this.ee),f=this.ee.get(\"events\"),l=(0,k.u5)(this.ee),h=(0,k.QU)(this.ee),g=(0,k.Gm)(this.ee);function m(e,t){h.emit(\"newURL\",[\"\"+window.location,t])}function v(){i++,n=window.location.hash,this[ve]=(0,p.z)()}function b(){i--,window.location.hash!==n&&m(0,!0);var e=(0,p.z)();this[pe]=~~this[pe]+e-this[ve],this[ye]=e}function y(e,t){e.on(t,(function(){this[t]=(0,p.z)()}))}this.ee.on(ve,v),s.on(be,v),a.on(be,v),this.ee.on(ye,b),s.on(ge,b),a.on(ge,b),this.ee.buffer([ve,ye,\"xhr-resolved\"],this.featureName),f.buffer([ve],this.featureName),u.buffer([\"setTimeout\"+le,\"clearTimeout\"+fe,ve],this.featureName),d.buffer([ve,\"new-xhr\",\"send-xhr\"+fe],this.featureName),l.buffer([me+fe,me+\"-done\",me+he+fe,me+he+le],this.featureName),h.buffer([\"newURL\"],this.featureName),g.buffer([ve],this.featureName),s.buffer([\"propagate\",be,ge,\"executor-err\",\"resolve\"+fe],this.featureName),o.buffer([ve,\"no-\"+ve],this.featureName),a.buffer([\"new-jsonp\",\"cb-start\",\"jsonp-error\",\"jsonp-end\"],this.featureName),y(l,me+fe),y(l,me+\"-done\"),y(a,\"new-jsonp\"),y(a,\"jsonp-end\"),y(a,\"cb-start\"),h.on(\"pushState-end\",m),h.on(\"replaceState-end\",m),window.addEventListener(\"hashchange\",m,(0,O.m$)(!0,this.removeOnAbort?.signal)),window.addEventListener(\"load\",m,(0,O.m$)(!0,this.removeOnAbort?.signal)),window.addEventListener(\"popstate\",(function(){m(0,i>1)}),(0,O.m$)(!0,this.removeOnAbort?.signal)),this.abortHandler=this.#e,this.importAggregator()}#e(){this.removeOnAbort?.abort(),this.abortHandler=void 0}}],loaderType:\"spa\"})})(),window.NRBA=o})(); window.jQuery || document.write(' ') CKEDITOR_BASEPATH='https://f1000research.com/js/vendor/ckeditor/' window.reactTheme = 'research'; window.MathJax = { CommonHTML: { linebreaks: { automatic: true } }, 'HTML-CSS': { linebreaks: { automatic: true } }, SVG: { linebreaks: { automatic: true } }, AuthorInit: function() { MathJax.Hub.Register.MessageHook('End Process', function () { let timeout = false; // holder for timeout id const delay = 250; // delay after event is \"complete\" to run callback const reflowMath = function() { const dispFormulas = document.querySelectorAll('.disp-formula.panel'); if (!dispFormulas) { return; } for (const dispFormula of dispFormulas) { const child = dispFormula.querySelector('.MathJax_Preview').nextSibling.firstChild; const isMultiline = MathJax.Hub.getAllJax(dispFormula)[0].root.isMultiline; if (dispFormula.offsetWidth < child.offsetWidth || isMultiline) { MathJax.Hub.Queue(['Rerender', MathJax.Hub, dispFormula]); } } }; window.addEventListener('resize', function() { clearTimeout(timeout); // clear the timeout timeout = setTimeout(reflowMath, delay); // start timing for event \"completion\" }); }); }, }; if (window.location.hash == '#_=_'){ window.location = window.location.href.split('#')[0] } !function(f,b,e,v,n,t,s){if(f.fbq)return;n=f.fbq=function() {n.callMethod? n.callMethod.apply(n,arguments):n.queue.push(arguments)} ;if(!f._fbq)f._fbq=n; n.push=n;n.loaded=!0;n.version='2.0';n.queue=[];t=b.createElement(e);t.async=!0; t.src=v;s=b.getElementsByTagName(e)[0];s.parentNode.insertBefore(t,s)}(window, document,'script','https://connect.facebook.net/en_US/fbevents.js'); fbq('init', '1641728616063202'); fbq('track', \"PixelInitialized\", {}); (function(h,o,t,j,a,r){ h.hj=h.hj||function(){(h.hj.q=h.hj.q||[]).push(arguments)}; h._hjSettings={hjid:2318163,hjsv:6}; a=o.getElementsByTagName('head')[0]; r=o.createElement('script');r.async=1; r.src=t+h._hjSettings.hjid+j+h._hjSettings.hjsv; a.appendChild(r); })(window,document,'https://static.hotjar.com/c/hotjar-','.js?sv='); search file_upload Submit your research search menu close search Browse Gateways & Collections How to Publish Submit your Research My Submissions Article Guidelines Article Guidelines (New Versions) Open Data, Software and Code Guidelines Open Data and Accessible Source Materials Guidelines (HSS) Open Data, Software and Code Guidelines (PSE) Prepublication Checks Production Process Posters and Slides Guidelines Document Guidelines Article Processing Charges Peer Review Finding Article Reviewers About How it Works For Reviewers Our Advisors Policies Glossary FAQs For Developers Newsroom Contact My Research Submissions Content and Tracking Alerts My Details Sign In file_upload Submit your research <input type=\"hidden\" id=\"meta-article-title\" value=\"Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1\" /> { \"@context\": \"https://schema.org\", \"@type\": \"ScholarlyArticle\", \"mainEntityOfPage\": { \"@type\": \"WebPage\", \"@id\": \"https://f1000research.com/articles/12-1\" }, \"headline\": \"Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in...\", \"datePublished\": \"2023-01-03T11:38:21\", \"dateModified\": \"2024-11-25T17:26:14\", \"author\": [ { \"@type\": \"Person\", \"name\": \"Shania Safera Tandio Saputro\" }, { \"@type\": \"Person\", \"name\": \"Khayu Wahyunita\" }, { \"@type\": \"Person\", \"name\": \"Astutiati Nurhasanah\" }, { \"@type\": \"Person\", \"name\": \"Yudhi Nugraha\" }, { \"@type\": \"Person\", \"name\": \"Irvan Faizal\" }, { \"@type\": \"Person\", \"name\": \"Sabar Pambudi\" }, { \"@type\": \"Person\", \"name\": \"Syahputra Wibowo\" }, { \"@type\": \"Person\", \"name\": \"Andri Pramesyanti Pramono\" } ], \"publisher\": { \"@type\": \"Organization\", \"name\": \"F1000Research\", \"logo\": { \"@type\": \"ImageObject\", \"url\": \"https://f1000research.com/img/AMP/F1000Research_image.png\", \"height\": 480, \"width\": 60 } }, \"image\": { \"@type\": \"ImageObject\", \"url\": \"https://f1000research.com/img/AMP/F1000Research_image.png\", \"height\": 1200, \"width\": 150 }, \"description\": \"Green Fluorescent Protein (EGFP) is widely used as a reporter gene, aiding in protein recovery and transduction studies. In this study, EGFP was tagged with eleven arginine residues (PolyR) and six histidine residues (His-tag) for purification. The aim was to enhance the synthesis of EGFP-PolyR in Saccharomyces cerevisiae and evaluate the effects of polyarginine modification on protein stability and expression levels. The expression of EGFP and EGFP-PolyR in S. cerevisiae was assessed through fluorescence measurements and protein levels. Structural analyses were conducted using in silico tools to investigate changes in beta strands and helices, which were validated through Western blots. Results showed that EGFP-PolyR maintained similar fluorescence levels to EGFP, but with notable structural changes. EGFP-PolyR's final beta strand terminates at Ala228, compared to Gly229 in EGFP, affecting the beta sheet's stability. Structural modifications also included altered helix lengths, with a longer helix 10 and shorter helix 9 in EGFP-PolyR. These alterations, along with shifts in helix-helix interactions, contribute to destabilization. Additionally, EGFP-PolyR exhibited unique gamma coils absent in EGFP, further differentiating its structure. The structural changes led to decreased protein expression and solubility, as indicated by Western blot analysis, with EGFP-PolyR showing significantly lower expression levels. The findings suggest that EGFP-PolyR is prone to aggregation and misfolding, characteristics often associated with aggregation-prone proteins.In conclusion, the polyarginine modification significantly impacts the structural integrity, stability, and solubility of EGFP. While fluorescence is retained, these changes hinder protein detectability and purification, highlighting the importance of considering structural alterations when modifying reporter proteins for experimental use.\" } { \"@context\": \"http://schema.org\", \"@type\": \"BreadcrumbList\", \"itemListElement\": [ { \"@type\": \"ListItem\", \"position\": \"1\", \"item\": { \"@id\": \"https://f1000research.com/\", \"name\": \"Home\" } }, { \"@type\": \"ListItem\", \"position\": \"2\", \"item\": { \"@id\": \"https://f1000research.com/browse/articles\", \"name\": \"Browse\" } }, { \"@type\": \"ListItem\", \"position\": \"3\", \"item\": { \"@id\": \"https://f1000research.com/articles/12-1\", \"name\": \"Structural and Functional Implications of Polyarginine Addition to...\" } } ] } Home Browse Structural and Functional Implications of Polyarginine Addition to... ALL Metrics - Views Downloads Get PDF Get XML Cite How to cite this article Tandio Saputro SS, Wahyunita K, Nurhasanah A et al. Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.12688/f1000research.123181.3 ) NOTE: If applicable, it is important to ensure the information in square brackets after the title is included in all citations of this article. Close Copy Citation Details Export Export Citation Sciwheel EndNote Ref. Manager Bibtex ProCite Sente EXPORT Select a format first Track Share ▬ ✚ Research Article Revised Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] Previously titled: Expression of modified enhanced green fluorescent polyarginine protein in Saccharomyces cerevisiae INVSc1 Shania Safera Tandio Saputro https://orcid.org/0000-0001-6512-9612 1 , Khayu Wahyunita 2 , Astutiati Nurhasanah https://orcid.org/0000-0003-0912-6913 2 , [...] Yudhi Nugraha https://orcid.org/0000-0003-1186-4093 3,4 , Irvan Faizal https://orcid.org/0000-0002-7555-0678 1,2 , Sabar Pambudi https://orcid.org/0000-0003-0703-437X 2 , Syahputra Wibowo 3 , Andri Pramesyanti Pramono https://orcid.org/0000-0002-6516-9814 3,5,6 Shania Safera Tandio Saputro https://orcid.org/0000-0001-6512-9612 1 , Khayu Wahyunita 2 , [...] Astutiati Nurhasanah https://orcid.org/0000-0003-0912-6913 2 , Yudhi Nugraha https://orcid.org/0000-0003-1186-4093 3,4 , Irvan Faizal https://orcid.org/0000-0002-7555-0678 1,2 , Sabar Pambudi https://orcid.org/0000-0003-0703-437X 2 , Syahputra Wibowo 3 , Andri Pramesyanti Pramono https://orcid.org/0000-0002-6516-9814 3,5,6 PUBLISHED 25 Nov 2024 Author details Author details 1 Department of Biotechnology, Faculty of Biotechnology, Atma Jaya Catholic University of Indonesia, Tangerang, Jakarta Selatan, 15345, Indonesia 2 Centre for Vaccine and Drug Research, National Research and Innovation Agency Republic of Indonesia, Kawasan Puspiptek Serpong, Serpong, 15314, Indonesia 3 Research Centre of Molecular Biology Eijkman, National Reseach and Innovation Agency Republic of Indonesia, Kawasan Sains Teknologi Soekarno, Cibinong, 16911, Indonesia 4 National Reseach and Innovation Agency Republic of Indonesia, Jakarta, Jakarta Pusat, 10340, Indonesia 5 Stem Cell and Tissue Engineering Research Center, Universitas Pembangunan Nasional Veteran Jakarta, Jakarta, Jakarta Selatan, 12450, Indonesia 6 Medical Faculty, Universitas Pembangunan Nasioinal Veteran Jakarta, Jakarta, Jakarta Selatan, 12450, Indonesia Shania Safera Tandio Saputro Roles: Investigation, Methodology, Project Administration, Software, Writing – Original Draft Preparation Khayu Wahyunita Roles: Investigation, Methodology, Validation, Writing – Original Draft Preparation Astutiati Nurhasanah Roles: Investigation, Methodology, Project Administration, Supervision, Validation, Writing – Original Draft Preparation Yudhi Nugraha Roles: Conceptualization, Formal Analysis, Funding Acquisition, Investigation, Methodology, Supervision, Validation, Visualization, Writing – Original Draft Preparation Irvan Faizal Roles: Methodology, Validation Sabar Pambudi Roles: Conceptualization, Data Curation, Formal Analysis, Investigation, Methodology Syahputra Wibowo Roles: Formal Analysis, Visualization, Writing – Original Draft Preparation, Writing – Review & Editing Andri Pramesyanti Pramono Roles: Conceptualization, Formal Analysis, Funding Acquisition, Investigation, Methodology, Supervision, Validation, Visualization, Writing – Original Draft Preparation, Writing – Review & Editing OPEN PEER REVIEW DETAILS REVIEWER STATUS This article is included in the Cell & Molecular Biology gateway. Abstract Green Fluorescent Protein (EGFP) is widely used as a reporter gene, aiding in protein recovery and transduction studies. In this study, EGFP was tagged with eleven arginine residues (PolyR) and six histidine residues (His-tag) for purification. The aim was to enhance the synthesis of EGFP-PolyR in Saccharomyces cerevisiae and evaluate the effects of polyarginine modification on protein stability and expression levels. The expression of EGFP and EGFP-PolyR in S. cerevisiae was assessed through fluorescence measurements and protein levels. Structural analyses were conducted using in silico tools to investigate changes in beta strands and helices, which were validated through Western blots. Results showed that EGFP-PolyR maintained similar fluorescence levels to EGFP, but with notable structural changes. EGFP-PolyR's final beta strand terminates at Ala228, compared to Gly229 in EGFP, affecting the beta sheet's stability. Structural modifications also included altered helix lengths, with a longer helix 10 and shorter helix 9 in EGFP-PolyR. These alterations, along with shifts in helix-helix interactions, contribute to destabilization. Additionally, EGFP-PolyR exhibited unique gamma coils absent in EGFP, further differentiating its structure. The structural changes led to decreased protein expression and solubility, as indicated by Western blot analysis, with EGFP-PolyR showing significantly lower expression levels. The findings suggest that EGFP-PolyR is prone to aggregation and misfolding, characteristics often associated with aggregation-prone proteins.In conclusion, the polyarginine modification significantly impacts the structural integrity, stability, and solubility of EGFP. While fluorescence is retained, these changes hinder protein detectability and purification, highlighting the importance of considering structural alterations when modifying reporter proteins for experimental use. READ ALL READ LESS Keywords Saccharomyces cerevisiae INVSc1 protein expression, EGFP protein, protein transductions. Corresponding Author(s) Andri Pramesyanti Pramono ( [email protected] ) Close Corresponding author: Andri Pramesyanti Pramono Competing interests: No competing interests were disclosed. Grant information: The works were financially supported by the Universitas Pembangunan Nasional Veteran Jakarta, (Contract Nr. 001/UN.61.4/2020 and Nr. 001/UN.61.4/2021) DRPM Grant from Kemendikbud. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript. Copyright: © 2024 Tandio Saputro SS et al . This is an open access article distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. How to cite: Tandio Saputro SS, Wahyunita K, Nurhasanah A et al. Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.12688/f1000research.123181.3 ) First published: 03 Jan 2023, 12 :1 ( https://doi.org/10.12688/f1000research.123181.1 ) Latest published: 25 Nov 2024, 12 :1 ( https://doi.org/10.12688/f1000research.123181.3 ) Revised Amendments from Version 2 In this version, There are several changes and additions to the paper : 1. We have added Dr. Syahputra Wibowo as an author because he conducted the bioinformatics analysis for this revision. 2. There are several parts that we decided to change this paper, namely: - We have changed the title of this manuscript to reflect the additional data we have included. - Introduction part, we changed it according to the bioinformatics analysis results. - In the methodology section, we have incorporated protein structure analysis and structural analysis, thus completing the bioinformatic analysis. - In the results section, we have incorporated additional bioinformatic analysis images and comprehensive structural analysis tables for EGFP and EGFP-PolyR. - In the discussion section, the text has been modified and augmented in accordance with the incorporation of bioinformatic analysis data. - In conclusion, the conclusion was also modified in accordance with the alterations made to other sections of the manuscript. - In the extended data section, the figure previously published on figshare has been updated, and a new link has been included in this paper. - In the reference section, some references were deleted and new ones were added in accordance with the revisions made to this paper. In this version, There are several changes and additions to the paper : 1. We have added Dr. Syahputra Wibowo as an author because he conducted the bioinformatics analysis for this revision. 2. There are several parts that we decided to change this paper, namely: - We have changed the title of this manuscript to reflect the additional data we have included. - Introduction part, we changed it according to the bioinformatics analysis results. - In the methodology section, we have incorporated protein structure analysis and structural analysis, thus completing the bioinformatic analysis. - In the results section, we have incorporated additional bioinformatic analysis images and comprehensive structural analysis tables for EGFP and EGFP-PolyR. - In the discussion section, the text has been modified and augmented in accordance with the incorporation of bioinformatic analysis data. - In conclusion, the conclusion was also modified in accordance with the alterations made to other sections of the manuscript. - In the extended data section, the figure previously published on figshare has been updated, and a new link has been included in this paper. - In the reference section, some references were deleted and new ones were added in accordance with the revisions made to this paper. To read any peer review reports and author responses for this article, follow the \"read\" links in the Open Peer Review table. READ REVIEWER RESPONSES Introduction Enhanced green fluorescent protein (EGFP) has often been used as a reporter for protein transport, especially in eukaryotic cells such as mammalian and yeast cells. EGFP was derived from green fluorescent protein (GFP), a commonly used reporter protein that does not require a substrate for it to fluoresce. The EGFP gene is a mutated version of the GFP gene, with P64L and S65T mutations. These mutations cause a higher emission intensity in EGFP relative to that of the wild-type GFP, and better thermal stability of the EGFP protein, especially in eukaryotic cells. 1 EGFP can be used as a marker in optimizing protein isolation procedures and their functions. The fluorescence makes it easier for us to observe the localization of the expression of the protein. The intensity of EGFP fluorescence can also indicate the level of expression of the protein in a system. EGFP can also be used to study protein transfer, such as analysis of the work of a protein transduction system for cell reprogramming purposes. One of the uses of cell reprogramming is manufacturing induced pluripotent stem cells. Induced pluripotent stem cells are expected to be used as therapeutic cells for patients. Cell reprogramming can be done using protein transduction, viral transduction, or chemicals. Cell reprogramming by viral transduction can activate oncogenic genes, whereas chemical methods are highly unspecific and cannot be interpreted clearly. 2 , 3 On the other hand, protein transduction is reputed as a harmless method to deliver protein precisely. However, protein transduction has its disadvantages, such as low transduction efficiency in host cells. Therefore, research is needed to increase transduction proteins by modifying the target protein. Polyarginines are short polypeptides classified as non-amphipathic cell-penetrating peptides (NaCPP) and have cationic characteristics, including binding anionic lipid membranes; therefore, polyarginine can enter through the plasma membrane of eukaryotic cells. As a result, the NaCPP class is less toxic than the primary amphipathic and secondary cell-penetrating peptide (CPP). The NaCPP class uses endocytosis mechanisms with low concentrations for cellular uptake. 4 The amount of added arginine amino acid residues affect the cellular uptake’s efficiency level, whereas more arginine residues have a better efficiency level. Adding more than 15 amino acid residues decreases intracellular delivery efficiency. 5 Proteins fused to polyarginine are more efficiently transduced into human iPS cells compared to those without the addition of CPP. 6 In this research, we designed and constructed two proteins, EGFP and EGFP-PolyR. EGFP-PolyR is an EGFP protein with the addition of eleven arginine residues (polyarginine – polyR) at the C terminal of EGFP to be used as a transduction protein model for cell reprogramming purposes. The gene encoding EGFP and EGFP-PolyR was synthetically constructed and expressed in Saccha romyces cerevisiae INVSc1. The study aimed to investigate the pattern of EGFP-PolyR protein expression in S. cerevisiae INVSc1 compared to EGFP. This paper aims to contribute to the current understanding of structural modifications when optimizing reporter proteins for experimental applications. Methods Plasmid design and construction The gene encoding EGFP (GenBank Accession #U55762) and EGFP- PolyR (was synthetically made by IDT Custom Gene Synthesis cloned in a plasmid called pEGFP- PolyR, in such a way that it allowed sub-cloning of the gene with and without the polyR sequence, by using a different combination of restriction enzymes. In addition to the 11× arginine residues (polyR), codons encoding 6× histidine residues (6×His-tag) were also added downstream to the polyR codons. The synthetic gene was sub-cloned into pYES2CT, a Saccharomyces cerevisiae expression plasmid, during which the polyarginine codon either remained fused to the EGFP gene or was removed, creating recombinant pYES2CT pYES2CT-EGFP-PolyR or pYES2CT- EGFP, respectively. Since the pYES2CT plasmid has its own 6×His-tag downstream to its Multiple Cloning Sites (MCS), positioned in-frame with the EGFP and EGFP-PolyR codons, the expressed EGFP was expected to have one 6×His-tag, whereas the EGFP-PolyR were expected to have two. The intended digested fragments sized 821 bp (EGFP-PolyR) and 733 bp (EGFP), were gel-purified using GenepHlow Gel/PCR kit (DFH004) (GeneAid, Taiwan) with 20 μL elution buffer. The DNA concentration was measured using a BioDrop-Duo UV/Vis spectrophotometer (Thomas Scientific, United States). Then, the DNA was stored at -20°C. Ligation was carried out following the T4 DNA ligase procedure as described by the manufacturer (Promega, United States). The ligation was performed at 4°C overnight, with a plasmid-insert volume ratio of 1:10. Transformation of E. coli TOP10 The transformation into Escherichia coli TOP10 was carried out following the method of Abyadeh et al. (2017). 7 Recombinant E. coli cells were cultured in LB with 100 μg/mL ampicillin. Transformation by heat shock was carried out using the Scilogex SCI-100HCM-Pro Digital Thermal Mixer (United States) at 42°C for 90 seconds. The transformants were selected on LB agar with100 mg/mL ampicillin (LB Agar+Amp). Colony PCR was performed on selected transformants with pYES2CT-specific primers (Forward: 5′-AATATACCTCTATACTTTAACGTC-3′; Reverse 5′-GAGGGCGTGAATGTAAGCGTGAC-3′) to verify the presence of intended inserts. PCR was done using Biometra Tone Thermal Cyclers (Analytik Jena AG, Germany) and carried out following the procedure from MyTaq Red Mix (Bioline, UK) manufacturer, for 35 cycles, with predenaturation (95°C) for 1 minute, denaturation for 15 seconds, annealing (55°C) for 15 seconds, elongation (72°C) for 10 seconds, and post elongation for 5 minutes. Transformation of Saccharomyces cerevisiae INVSc1 pYES2CT-EGFP- PolyR and pYES2CT-EGFP plasmids were isolated using ‘WizardPlus SV minipreps DNA purification kit (A1330) (Promega, United States)’ after being propagated in E. coli TOP10. Isolated plasmids were used to transform Saccharomyces cerevisiae INVSc1 with the lithium acetate (LiAc) method. 8 Transformants were selected on minimal medium (MM) agar without uracil. Plasmids were isolated from transformant colonies using the MP Biomedicals yeast plasmid isolation kit (MP Biomedicals, United States, Cat. 112069400). PCR was carried out to confirm the success of the transformation using Biometra Tone Thermal Cyclers (Analytik Jena AG, Germany) and carried out following the procedure from MyTaq Red Mix (Bioline, UK) manufacturer, for 35 cycles, with an annealing temperature of 55°C. Colony PCR was performed on selected transformants with pYES2CT-specific primers (Forward: 5′-AATATACCTCTATACTTTAACGTC-3′; Reverse 5′-GAGGGCGTGAATGTAAGCGTGAC-3′), to verify the presence of intended inserts. PCR was done using Biometra Tone Thermal Cyclers (Analytik Jena AG, Germany) and carried out following the procedure from MyTaq Red Mix (Bioline, UK) manufacturer, for 35 cycles, with predenaturation (95°C) for 1 minute, denaturation for 15 seconds, annealing (55°C) for 15 seconds, elongation (72°C) for 10 seconds, and post elongation for 5 minutes. Expression of the modified protein in Saccharomyces cerevisiae S. cerevisiae ’s fast-growing diploid strain INVSc1 (Invitrogen Corporation) was used as a host cell for protein expression. The yeasts were cultured in yeast-extract peptone dextrose (YEPD) medium. Recombinant cells of S. cerevisiae INVSc1 were cultured in a minimal medium (MM) without uracil. Protein expression followed the user guide of the pYES2CT plasmid (Invitrogen, 2003), with several modifications. A single colony of recombinant S. cerevisiae INVSc1 carrying pYES2CT-EGFP or pYES2CT-EGFP- PolyR was inoculated into 3 mL of MM medium; the culture was then incubated at 30°C 230 rpm for 48 hours. After that, a 1-mL culture was taken to measure its OD600 value. Culture with OD600 = 0.4 were subcultured into 100 mL of induction medium (MM medium containing 2% galactose and 1% raffinose). The cultures were further incubated after adding the induction medium for 48 to 72 hours. The culture was centrifuged at 5000 rpm for 10 minutes to harvest and stored in a freezer at -80 °C until further use. Fluorescent microscope visualization of EGFP and EGFP-PolyR Expression A 1 mL 10× diluted culture was centrifuged at 5000 rpm for five minutes. The pellet was then fixed with 500 μL 3.7% formaldehyde for 30 minutes. The cell suspension was centrifuged at 5000 rpm for 5 minutes, and the supernatant was discarded. as the remaining pellet was resuspended in 1 mL PBS 1×. A 50-μL fixed-cell suspension was placed in a well of 96-well plates (Thermo Scientific) to visualize the EGFP fluorescence under an inverted fluorescent microscope (Zeiss Axiovert 40 CFL, UK), (40× magnification, λ ex 488 nm and λ em 507 nm). Fluorescent intensity was measured using ImageJ software, and delta intensity was calculated as follows: ∆ Intensity t = Intensity t − Intensity 0 where, Intensity t is the fluorescent intensity at time t post-inoculation to induction medium Intensity 0 is the fluorescent intensity at time 0 post-inoculation to induction medium Statistical analysis All data were expressed as mean ± standard deviation. All statistical analyses were performed using SPSS software (IBM SPSS Statistics 24). The differences between groups were analyzed using one-way analysis of variance (ANOVA) after passed the homogeneity test and normality test, then proceeded to the Bonferroni post-hoc test. A p-value < 0.05 was considered as statistically significant. Detection of expressed protein Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) was carried out following the modified Iqbal and Ahmad (2016) method. The protein sample was mixed with 6× SDS gel loading buffer (600 mM Tris-Cl pH 6.8, 12% SDS, 30% glycerol (v/v), 0.03% bromophenol blue, and 20 mM DTT) and ran on 10 % SDS-PAGE gel at 100 V for 110 minutes until the bromophenol blue dye reached approximately 0.5 cm from the lower limit of the gel. 9 Western blotting was also carried out following the method of Iqbal and Ahmad (2016), with several modifications. Protein was transferred from gel to membrane (transfer buffer: 300 mM glycine, 300 mM Tris, 0.05% SDS) using Pierce Power Blotter (Thermo Scientific, United States) set at 25 kV, 1.3 A for 25 minutes. Then, the membrane was washed six times with PBST (PBS, 1% Tween-20) before applying the primary antibody (Anti-6×His-Tag monoclonal antibody (Invitrogen, catalog number MA1-21315) in blocking buffer (5% skim milk (Merck, Germany) in PBST), with 1:3000 ratio). Then the membrane was incubated at 4°C overnight before applying the secondary antibody (Goat anti-mouse IgG HRP, Invitrogen, catalog number 31430 in blocking buffer, with a ratio of 1:20,000 ratio) for 60 minutes with shaking (70 rpm). Then, the substrate (SuperSignal West Femto Luminol, Thermo Scientific, United States) was used. The duration of the exposure was 20 minutes. Protein structure modeling Protein structures were predicted using AlphaFold3, 10 a deep learning-based tool for accurate protein structure prediction. The input sequence for each protein was provided to AlphaFold3, which was run using the default settings. The predictions were performed on a high-performance computing cluster to ensure computational efficiency and accuracy. The output from AlphaFold2 included a predicted structure with confidence scores, which were used to assess the reliability of the model. Structural analysis Ramachandran Plot Analysis: The stereochemical quality of the AlphaFol3-predicted structures was assessed using the Ramachandran plot, which was generated using PROCHECK. PROCHECK is a widely used tool for evaluating the geometry of protein structures, specifically analyzing the distribution of phi (φ) and psi (ψ) dihedral angles. The structural models generated by AlphaFold2 were analyzed using PROMOTIF, a tool available through the PDBSum web server. 11 PROMOTIF was employed to examine key structural features and motifs within the predicted protein structures. This included the identification of secondary structure elements, analysis of protein-protein and protein-ligand interfaces, and evaluation of the overall geometry of the model. Results Construction of Plasmid pYES2CT-EGFP and pYES2CT-EGFP-PolyR and Transformation into Saccharomyces cerevisiae INVSc1 After digests and ligation processes were successfully performed ( Figure 1 and Figure 2A ), the ligation products, hereby called pYES2CT-EGFP and pYES2CT-EGFP-PolyR, for plasmid carrying egfp and egfp-poly R respectively, were propagated in E. coli TOP10. Plasmids isolated from this E.coli TOP10 that had been confirmed to have the correct size ( Figure 2B ) and carried the genes ( Figure 2C ) were then used to transform S. cerevisiae INVSc1. Screening of S. cerevisiae INVSc1 transformants was performed by PCR of purified plasmids. PCR results of positive colonies are presented in Figures 2D and 3 . Figure 1. The cloning process of genes encoding for EGFP and EGFP-PolyR into pYES2CT plasmid. Insertion of EGFP-PolyR gene was performed using the enzymes BamH1 (position 519) and Not1 (position 577) (A), whereas EGFP gene was inserted into pYES2CT plasmid using BamHI and EcoRI, thus leaving the PolyR fragment out (B). Figure 2. pEGFP-Poly R (lane 3) and pYES2CT (lane 9) were cut with restriction enzymes Not I and Bam HI, where pEGFP-Poly R produced egfp-polyR gene (822 bp band), and pYES2CT became linearized with size 5932 bp. pEGFP-Poly R (lane 5) and pYES2CT (lane 7) were cut with restriction enzymes Eco RI and Bam HI, where pEGFP-Poly R produced Egfp gene (733 bp band), and pYES2CT produced vector (5905 bp band) (A). The 822 and 733 bp DNA were isolated from gel, and ligated to the 5932 and 5905 bp bands, respectively. Single digest ( Bam HI) of plasmids isolated from E.coli TOP10 transformed with pYES2CT-EGFP (lane 3 and 4) and pYES2CT-EGFP-Poly R (lane 5 and 6), in comparison to wild type pYES2CT (lane 2), showed that the plasmid sizes were correct (B). Also, colony PCR of E.coli confirmed the presence of the intended genes as 1037bp and 1098bp bands, representing the Egfp and Egfp-polyR , respectively (C). Transformed yeast colony screening was performed by PCR of plasmids purified from the yeast, using pYES2CT-specific primers. As a control, pYES2CT plasmid was used (lane K). Lanes 1-15 showed PCR amplification results of plasmids isolated from S. ce revisiae culture, transformed with pYES2CT (lanes 1-5), pYES2CT-EGFP-Poly R (lanes 6-10), and pYES2CT-EGFP (lanes 11-15). Amplification of pYES2CT without insert (lane 1-5) shows the same size amplicons as a positive control (K), which are 334 bp, amplification of pYES2CT-EGFP-Poly R produced amplicons of 1097 bp (lane 6-10), while the pYES2CT-EGFP produced amplicons of 1036 bp (lane 11-15) (D). Lane M is GeneRuler 1kb DNA Ladder (Thermo Scientific SM0312). Figure 3. Positive E. coli TOP10 and S. cer evisiae INVSc1 transformants are carrying plasmids pYES2CT-EGFP (A3 and B3, respectively) and pYES2CT-EGFP-PolyR (A4 and B4, respectively). Transformation positive controls are shown in A1 and B1, whereas the negative controls are in A2 and B2. The role of EGFP and EGFP-PolyR addition on the growth curve of Saccharomyces cerevisiae INVSc1 The growth curve showed that post-induction S. cerevisiae INVSc1 stayed longer at the exponential phase when not carrying any plasmid in comparison to the same strain with pYES2CT plasmids ( Figure 4 ). The plasmid-carrying yeasts seemed to reach stationary phase 24 hours after inoculation to induction medium ( Figure 4B and C ), whereas the wild-type culture stayed at exponential phase for up to 64 hours ( Figure 4A ) before slowing down its growth. There is a significant decrease of the growth curve in S. cerevisiae INVSc1 carrying the plasmids EGFP and EGFP-PolyR, compared to the wildtype. The significant decrease was seen from 48 – 72 hours ( Figure 4D ). Figure 4. Growth curve comparison of Saccharomyces cerevisiae INVSc1 without plasmid (A), carrying pYES2CT- EGFP (B), carrying pYES2CT-EGFP-PolyR plasmid (C), in the induction medium (containing 2% galactose and 1% raffinose). The growth comparison of Saccharomyces cerevisiae INVSc1 on 48 hours and 72 hours (D). Optical densities were measured at λ=660nm, 48 hours, and 72 hours post-inoculation to induction medium of the wild-type and recombinant S. cerevisiae (D). The result reported are mean of four replicates while the error bar indicates its standard deviation. Mean data accompanied by different letter in each time point are significantly different (Bonferroni test, p < 0.05). The fluorescence produced post-inoculation to induction medium by each recombinant yeast and wild-type yeast is presented in Figure 5A . The Δintensity was calculated and presented as a graph in Figure 5B . There was a significant difference between wildtype fluresens expression with recombinant yeast carrying pYES2CT EGFP and pYES2CT EGFP PolyR-plasmid on 48 hours and 72 hours. The addition of pYESC2 EGFP and pYES2CT EGFP PolyR plasmids significantly inhibited the proliferation of S. cerevisiae starting at 48 hours. Western blotting using anti-his-tag mouse monoclonal antibody (primary antibody) and Goat anti-mouse IgG HRP (secondary antibody) proved that the EGFP-PolyR and EGFP proteins were expressed in S. cerevisiae INVSc1 at similar ( Figure 6 ). Figure 5. The fluorescence expressed by S. cerevisiae INVSc1 carrying no plasmid (wild-type), and carrying pYES2CT-EGFP and pEGFP-PolyR plasmids at 48, and 72 hours post-inoculation to induction medium (A), the calculated Δintensity of each yeast at 48- and 72-hour post inoculation to induction medium (B). The result reported are mean of six replicates while the error bar indicates its standard deviation. Mean data accompanied by different letter in each time point are significantly different (Bonferroni test, p < 0.05). Figure 6. Western blotting of protein expressed at 48 hours post-inoculation to induction medium by S. cerevisiae INVSc1 carrying no plasmid (Lane 1 and 2), pYES2CT-EGFP (Lane 3 and 4), and pYES2CT-EGFP-PolyR (Lanes 5 and 6). The Western blot was performed using an anti-his-tag antibody as the primary antibody. Bioinformatic analysis The beta strand structures of EGFP-Poly R and EGFP exhibit a critical difference in the length of the final beta strand. In EGFP-Poly R, the last beta strand ends at Ala228, whereas in EGFP, it extends one residue further to Gly229. This difference could impact the structural stability of the beta sheet, as the absence of the glycine residue in EGFP-Poly R might reduce the flexibility and stability of this structural element. In addition to differences in beta strands, there are notable variations in the helical structures of EGFP and EGFP-Poly R. EGFP features a total of 11 helices, including both G and H types, while EGFP-Poly R has only 10 helices, missing one compared to EGFP ( Table 1 and Table 2 ). This reduction in helices could significantly affect the overall stability and integrity of the protein structure, as helices play a crucial role in maintaining protein stability. Notably, helix 10 in EGFP spans from Leu251 to Ser253, comprising 3 residues, whereas in EGFP-Poly R, it extends to 5 residues, from Pro265 to Leu269 ( Figure 7 and Figure 8 ). This extension may reflect a structural adjustment due to the additional arginine residues in the Poly R sequence. Conversely, helix 9 in EGFP-Poly R, spanning from Pro245 to Trp248, shows decreased length and stability with a lower pitch and rise per residue compared to EGFP, suggesting potential instability. Both EGFP and EGFP-Poly R deviate from ideal helical parameters, but EGFP-Poly R exhibits slightly greater deviations in helix 9, indicating possible structural strain from the Poly R modification. The extension of helix 10 by two additional residues in EGFP-Poly R might be a direct consequence of this modification, altering the local structural environment. These differences in the beta strands and helices between EGFP and EGFP-Poly R likely contribute to the overall destabilization of the protein. The shortening of the final beta strand, combined with changes in helix lengths and stability, particularly the extension of helix 10 could lead to misfolding or reduced structural integrity of EGFP-Poly R ( Figure 8 ). Additionally, the interactions between helices show some important differences. The helix-helix interactions between EGFP and EGFP-Poly R reveal subtle yet significant differences that could impact the stability of the protein. Both proteins share similarities in certain interactions, such as those between helices A1 and A5, A1 and A6, A2 and A3, and A5 and A6, with nearly identical distances and angles. However, differences arise in the interactions between helices A5 and A8, and A8 and A9. In EGFP, the A5-A8 interaction has a distance of 10.6 Å with an angle of -102.9°, while in EGFP-Poly R, this distance shortens to 10.0 Å with an angle of -100.5°. More notably, the A8-A9 interaction shows a distance of 2.6 Å with an angle of -79.3° in EGFP, but in EGFP-Poly R, the distance increases to 3.2 Å with a significant angle shift to -94.9°, and an increase in the number of interacting residues from 4 to 6. These differences suggest altered packing and potential destabilization of the protein structure in EGFP-Poly R. The changes in helix-helix interaction, particularly between A8 and A9, could contribute to a less stable conformation in EGFP-Poly R. Table 1. Comprehensive structural of EGFP. Structure type Start End Sequence Turn Type/Type Length/No. Resid Class/ H-Bond/Topology/Interaction Type/Helices Beta Hairpins Val12 Val23 12 Strands 2:2 IP His26 Asp37 12 Strands 4:4 I Tyr93 Phe101 9 Strands 3:5 Asn106 Glu116 11 Strands 2:2 IIP His149 Asp156 8 Strands 4:4 I Gly161 Asn171 11 Strands 3:5 His200 Ser209 10 Strands 10:10 Beta Bulges Phe101 Asp104 Gly105 Classic Antiparallel H-Bond: Yes Ile172 Gly175 Ser176 G1 Antiparallel H-Bond: Yes Strands Val12 Val23 12 Residues His26 Asp37 12 Residues Lys42 Cys49 8 Residues Tyr93 Phe101 9 Residues Asn106 Glu116 11 Residues Thr119 Ile129 11 Residues His149 Asp156 8 Residues Gly161 Asn171 11 Residues Val177 Pro188 12 Residues His200 Ser209 10 Residues His218 Gly229 12 Residues Helices Lys4 Phe9 Helix G 6 Residues Trp58 Leu61 Helix G 4 Residues Val62 Leu65 Helix G 4 Residues Gln70 Phe72 Helix G 3 Residues Asp77 His82 Helix G 6 Residues Phe84 Ser87 Helix H 4 Residues Lys157 Lys159 Helix H 3 Residues Met234 Arg243 Helix H 10 Residues Pro245 Trp248 Helix H 4 Residues Leu251 Ser253 Helix G 3 Residues Pro265 Gly268 Helix G 4 Residues Helix-Helix Interactions A1 A5 G G n c 1 interacting residue A1 A6 G H c 3 1 interacting residue A2 A3 G H c n 4 interacting residues A5 A6 G H c n 1 interacting residue A8 A9 G H I 2 interacting residues Beta Turns Asp22 Gly25 DVNG IV H-Bond: Yes Val23 His26 VNGH I H-Bond: Yes Asp37 Tyr40 DATY I H-Bond: Yes Ala38 Gly41 ATYG I Cys49 Gly52 CTTG I H-Bond: Yes Leu65 Gly68 LTYG I Thr66 Val69 TYGV I H-Bond: Yes Tyr67 Gln70 YGVQ IV Ala88 Glu91 AMPE VIa1 Met89 Gly92 MPEG I Phe101 Asp104 FKDD IV H-Bond: Yes Phe115 Asp118 FEGD IV Glu116 Thr119 EGDT II' H-Bond: Yes Lys132 Gly135 KEDG I H-Bond: Yes Gly135 Leu138 GNIL IV Asn136 Gly139 NILG I Ile137 His140 ILGH I H-Bond: Yes Ile172 Gly175 IEDG I H-Bond: Yes Asp211 Glu214 DPNE I H-Bond: Yes Gly229 Leu232 GITL IV H-Bond: Yes Gamma Turns His82 Phe84 HDF INVERSE Glu143 Asn145 EYN INVERSE Gly268 Asp270 GLD INVERSE Thr272 Thr274 TRT INVERSE Gly275 His277 GHH INVERSE His276 His278 HHH INVERSE His278 His280 HHH INVERSE Table 2. Comprehensive Structural of EGFP-POLY R. Structure type Start End Sequence Type/Turn Type Length/No. Resid Class/Interaction/H-Bond/Topology Beta Sheet Mixed 11 strands Topology: -1 -1 5X -1-1 5-1 -1 3 1 Beta Hairpins Val12 Val23 Hairpin 12 residues 2:2 IP His26 Asp37 Hairpin 12 residues 4:4 I Tyr93 Phe101 Hairpin 9 residues 3:5 Asn106 Glu116 Hairpin 11 residues 2:2 IIP His149 Asp156 Hairpin 8 residues 4:4 I Gly161 Asn171 Hairpin 11 residues 3:5 His200 Ser209 Hairpin 10 residues 10:10 Beta Bulges Phe101 Asp104 Gly105 Bulge Antiparallel H-Bond: Yes Ile172 Gly175 Ser176 Bulge Antiparallel H-Bond: Yes Strands Val12 Val23 Strand 12 residues His26 Asp37 Strand 12 residues Lys42 Cys49 Strand 8 residues Tyr93 Phe101 Strand 9 residues Asn106 Glu116 Strand 11 residues Thr119 Ile129 Strand 11 residues His149 Asp156 Strand 8 residues Gly161 Asn171 Strand 11 residues Val177 Pro188 Strand 12 residues His200 Ser209 Strand 10 residues His218 Ala228 Strand 11 residues Helices Lys4 Phe9 Helix 6 residues Trp58 Leu61 Helix 4 residues Val62 Leu65 Helix 4 residues Gln70 Phe72 Helix 3 residues Asp77 His82 Helix 6 residues Phe84 Ser87 Helix 4 residues Lys157 Lys159 Helix 3 residues Met234 Arg243 Helix 10 residues Pro245 Trp248 Helix 4 residues Pro265 Leu269 Helix 5 residues Helix-Helix Interactions A1 A5 G G n c 1 interacting residue A1 A6 G H I c 3 interacting residues A2 A3 G H c n 4 interacting residues A5 A6 G H c n 1 interacting residue A8 A9 G H I 2 interacting residues Beta Turns Asp22 Gly25 DVNG Turn IV H-Bond: Yes Val23 His26 VNGH Turn I H-Bond: Yes Asp37 Tyr40 DATY Turn I H-Bond: Yes Ala38 Gly41 ATYG Turn I Cys49 Gly52 CTTG Turn I H-Bond: Yes Leu65 Gly68 LTYG Turn IV H-Bond: Yes Thr66 Val69 TYGV Turn I H-Bond: Yes Tyr67 Gln70 YGVQ Turn IV Ala88 Glu91 AMPE Turn VIa1 Met89 Gly92 MPEG Turn I Phe101 Asp104 FKDD Turn II H-Bond: Yes Phe115 Asp118 FEGD Turn IV Glu116 Thr119 EGDT Turn II H-Bond: Yes Lys132 Gly135 KEDG Turn I H-Bond: Yes Gly135 Leu138 GNIL Turn IV Asn136 Gly139 NILG Turn I Ile137 His140 ILGH Turn I H-Bond: Yes Ile172 Gly175 IEDG Turn I H-Bond: Yes Asp211 Glu214 DPNE Turn I H-Bond: Yes Gamma Turns His82 Phe84 HDF Turn INVERSE Glu143 Asn145 EYN Turn INVERSE Phe257 Gly259 FEG Turn INVERSE Leu269 Ser271 LDS Turn INVERSE Ser272 Arg275 TRT Turn INVERSE Thr277 Arg278 GRR Turn INVERSE Arg276 Gly277 TGR Turn INVERSE Figure 7. Bioinformatic analysis of EGFP (yellow = 6x HisTag). Figure 8. Bioinformatic analysis of EGFP-Poly R (red = Poly R and yellow = 6x HisTag). The comparison of beta turns between EGFP and EGFP-Poly R reveals several unique structural differences that highlight how modifications in the sequence can influence the protein's conformation. One notable difference is observed in the Leu65-Gly68 turn. EGFP exhibits a phi angle of -89.7° and a psi angle of -39.1°, while EGFP-Poly R shows a significantly more negative phi angle of -102.1° and a psi angle of -35.1°. This change in the phi angle suggests a more pronounced deviation in the turn's geometry in EGFP-Poly R compared to EGFP. Additionally, the chi1 angles are 51.1° for EGFP and 47.1° for EGFP-Poly R, reflecting an adjustment in the side-chain orientation due to the extended polyarginine sequence. Another distinct difference is found in the Phe115-Asp118 turn. EGFP has a phi angle of -125.8° and a psi angle of 100.9°, whereas EGFP-Poly R shows a less negative phi angle of -121.3° and a psi angle of 98.3°. The chi1 angles for EGFP are -65.5°, while for EGFP-Poly R, they are -66.0°. The shift in the phi and psi angles in EGFP-Poly R indicates a possible alteration in the turn’s local conformation, potentially affecting interactions with neighboring regions. The Asp211-Glu214 turn presents another unique aspect. EGFP has a phi angle of -63.7° and a psi angle of -16.3°, whereas EGFP-Poly R shows slightly different angles with a phi of -64.6° and a psi of -16.1°. This minimal difference in phi and psi angles, along with chi1 angles of 26.5° for EGFP and 26.8° for EGFP-Poly R, highlights subtle adjustments in the beta turn’s configuration. Another differences in the Leu65-Gly68 turn, in EGFP, this turn is of the I type, suggesting a more regular and stable loop structure at this position. In contrast, in EGFP-Poly R, the same region forms an IV type turn, indicating increased flexibility or a less well-defined structure, which could lead to differences in the local stability of the protein. The I type turn is a common secondary structure element in proteins where four consecutive residues create a turn in the polypeptide chain. In this type of turn, the first and fourth residues are hydrogen-bonded, creating a tight loop. The phi (Φ) and psi (Ψ) angles typically found in I type turns are around -60° for Φ and -30° to -60° for Ψ. These angles contribute to the formation of a stable turn, often found in beta-hairpins or at the end of beta strands. The IV type turn is a more flexible and less common turn compared to type I. It doesn’t conform to a specific set of phi and psi angles and is often seen as a more irregular or less tightly constrained turn. This flexibility means that IV type turns can vary more in their structure, leading to different folding patterns or conformations in the protein. Because of its variability, an IV type turn can introduce local flexibility or disorder in a protein structure, potentially affecting the overall stability of the region. Flexible or irregular turn like the IV type could make the protein more prone to misfolding or less resistant to environmental stressors. 12 The last one is the difference of gamma turns between EGFP and EGFP-Poly R reveals significant structural differences that likely influence their stability and functionality. EGFP features seven gamma turns ( Table 1 ), whereas EGFP-Poly R contains nine, indicating that the poly-arginine modification introduces additional structural elements ( Table 2 ). Among the common gamma turns, the His82 to Phe84 turn shows minor differences. In EGFP, the phi angle is -85.6°, psi is 82.4°, chi1 is -168.5°, with a CA distance of 6.0 Å. For EGFP-Poly R, the phi angle is -86.3°, psi is 83.0°, chi1 is -169.3°, and the CA distance remains 6.0 Å. Similarly, the Glu143 to Asn145 turn in EGFP has a phi angle of -84.5°, psi of 65.2°, chi1 of -171.6°, with a CA distance of 5.6 Å. In EGFP-Poly R, the corresponding values are phi -83.9°, psi 65.6°, chi1-170.0°, and CA distance 5.6 Å. EGFP also has unique gamma turns not present in EGFP-Poly R. The Gly268 to Asp270 turn, with a phi angle of -84.6°, psi of 69.5°, chi1 of -70.8°, and a CA distance of 5.8 Å, is missing in EGFP-Poly R. Its absence may lead to reduced flexibility and altered local folding. Similarly, the Thr272 to Thr274 turn, with phi of -72.7°, psi of 62.5°, chi1 of -78.9°, and CA distance of 5.4 Å, is also not found in EGFP-Poly R. The Gly275 to His277 turn, with phi of -65.9°, psi of 95.2°, chi1 of -86.4°, and a CA distance of 5.8 Å, is absent in EGFP-Poly R. On the other hand, EGFP-Poly R includes several unique gamma turns not observed in EGFP. The Phe257 to Gly259 turn, with phi of -61.9°, psi of 76.0°, chi1 of -74.2°, and a CA distance of 5.0 Å, introduces new conformational possibilities. The Leu269 to Ser271 turn, with phi of -75.5°, psi of 58.9°, chi1 of -152.5°, and a CA distance of 5.5 Å. The Thr272 to Thr274 turn in EGFP-Poly R, with phi of -56.1°, psi of 83.6°, chi1 of -80.3°, and a CA distance of 5.7 Å, differs from its counterpart in EGFP. Then Gly275 to Arg277 turn, with phi of -82.1°, psi of 91.4°, chi1 of -94.9°, and a CA distance of 6.0 Å, reflects a structural modification that might influence the protein's overall folding. Discussion The addition of PolyR residues did not affect the expression of EGFP fluorescence in the Saccharomyces cerevisiae cell In this study, PolyR was added to EGFP protein to function as a cell-penetrating peptide (CPP), which is commonly used as a carrier of protein into cells. Arginine-rich CPP has been used as a carrier for the intracellular delivery of various bioactive molecules such as proteins, peptides, and nucleic acids. The number of arginine residues used as CPP can affect the efficiency of cellular uptake and cytosolic release. It is well understood that high cellular uptake efficiency is achieved with 8-12 residues. 13 Polyarginine as CPP also plays an essential role in forming hydrogen bonds with cell membrane protein groups. 14 The expression of EGFP protein, as inferred from the fluorescence and Western blot data, indicated that the induction of the recombinant cultures was successful. Analysis performed at 48 and 72 hours post-inoculation to induction medium showed no increase in fluorescent intensity with time ( Figure 5B ). Thus, in the future, this could be used as a reference supporting that it would only take 48 hours of culturing for expression, hence being more time-efficient. It is known that the addition of a CPP sequence can have a negative influence on recombinant protein yield. 15 It was reported that ten arginines (R10) residues were added to the superfolder GFP (sfGFP) N-terminal in pBAD plasmid containing arabinose-inducible sfGFP gene with a C-terminal His tag. No recombinant R10-sfGFP was expressed by E. coli TOP10. However, the unmodified sfGFP gene expressed over 30 mg/L protein under the same condition. 16 It was also reported that although the fluorescent protein obtained after purification showed a single band on SDS-PAGE, mass spectrometry (MS) analysis revealed truncation of the R10, leaving only two arginine residues present at the C-terminus upon expression when the position of R10 and His-tag was swapped relative to the sfGFP gene ( i.e. His tag at the N-terminus and R10 at the C-terminus). 17 In contrast to these previous findings, our result indicated that the addition of a PolyR group to the C-terminal of EGFP carrying C-terminal 6×His-tag did not seem to interfere with protein expression in S. cerevisiae INVSc1, as shown by the similar fluorescence ( Figure 5B ) and protein ( Figure 6 ) levels expressed by yeasts carrying pYES2CT-EGFP band pYES2CT-EGFP-PolyR. In combination with the data from the proteins tertiary structural predictions and alignment, this expression result indicated that the conformational change caused by the addition of PolyR did not affect the protein expression. It would be interesting to observe whether relocating the 6×His-tag or the PolyR to different terminals would improve the protein expression as well as provide ease of purification since it is feared that the PolyR can interfere with the binding of 6×His-tag to Ni-NTA resin to be used for purification or the anti-His-tag antibody used for detection of expression. Modified protein plasmid insertion causes a decrease in the growth curve of S. cerevisiae The lower growth curve of the transformant S. cerevisiae compared to the wild-type can be due to the growth inhibition factors of S. cerevisiae activated due to the addition of MM induction medium (2% galactose and 1% raffinose). Adding raffinose to the growth medium of S. cerevisiae can activate the programmed cell death formation of acetic acid. Guaragnella's study (2013) suggests that S. cerevisiae is resistant to programmed cell death via acetic acid because S. cerevisiae can compensate by activating retrograde mitochondria. Although programmed cell death is activated, they are not necessarily inhibited by growth. 16 In addition, previous studies have shown that high-level expression of a EGFP protein localized to an intracellular compartment is expected to cause cellular defects because it overloads localization processes and growth defects. 17 , 18 This causes a significant decrease in the growth curve of yeast containing plasmids EGFP and EGFP PolyR. Even so, the low growth curve of the transformant S. cerevisiae seems does not affect the expression of EGFP fluorescence proteins ( Figures 5A and 5B and 2 ). Previous research has shown that PolyR expression in cells can cause protein translation stalls. 19 Results in experiments showed that the addition of PolyR at the C terminal did not cause the EGFP protein translation stall, only a decrease of the growth curve significantly. This is possible because our plasmid vectors have been designed to express them in sufficient quantities within the cell. Structural alterations of EGFP-Poly R lead to reduced Western blot detection The reduced detection of EGFP-Poly R in Western blot assays, compared to native EGFP, stems from significant structural alterations caused by the poly-arginine modifications. EGFP-Poly R exhibits a truncated final beta strand and a reduced number of helices, leading to decreased stability and increased susceptibility to misfolding and aggregation. Additionally, changes in the lengths and angles of helices, as well as the introduction of new gamma turns, contribute to structural strain and potential instability. 20 These modifications result in reduced solubility and altered epitope accessibility, making EGFP-Poly R more prone to proteolytic cleavage during sample preparation. Consequently, while EGFP-Poly R is expressed within cells, its aggregated and unstable forms are less detectable in Western blots, unlike the more stable and detectable native EGFP. 21 Histag addition can cause protein instability. It would seem prudent to suggest that some cases of histag may result in increased aggregation, disruption to protein folding, proteolytic changes of cleavage, and a combination of these factors, which could be 8X more significant than 6X. 22 – 24 Conclusions It is imperative to stress that poly-arginine causes significant changes with regard to the structure of EGFP and affects the stability and solubility of the protein. However, it is rather reassuring that the fluorescence of EGFP-PolyR is preserved at similar levels. However, the changes in the secondary structure elements, such as beta-strands, helices, and turns, as well as the increase in protein instability, should not be disregarded as they do influence the detectability and overall usefulness of the antibody in protein immobilization and isolation/analysis. Which proves the fact that structural alteration should be taken into account when optimizing the reporter proteins for the experimental purposes. Data availability Underlying data Figshare: Growth curve of Saccharomyces cerevisiae with and without plasmid insertion. A. Growth curve of Saccharomyces cerevisiae without plasmid, https://doi.org/10.6084/m9.figshare.19759018.v1 . 25 Figshare: The fluorescence of Saccharomyces cerevisiae without transformation and with transformation (pYES2CT- EGFP/ EGFP plasmid, pYES2CT-EGFP- PolyR/EGFP Polyarginine plasmid) at OD 600 on 48 hours and 72 hours, https://doi.org/10.6084/m9.figshare.19762699.v2 . 26 Extended data Figshare: Figure 1-7, https://doi.org/10.6084/m9.figshare.25388371 . 27 Figshare: Attachment, https://doi.org/10.6084/m9.figshare.19767589.v8 . 28 Data are available under the terms of the Creative Commons Attribution 4.0 International license (CC-BY 4.0). Acknowledgments We would like to thank Program SAME Direktorat Sumber Daya, DRPM Ditjen Diktiristek, Kemendikbud Tahun 2022, and LPPM UPNVJ for their support in this study. References 1. Muhammad N, Kryuchkova N, Dworeck T, et al. : Enhanced EGFP Fluorescence Emission in Presence of PEG Aqueous Solutions and PIB1000-PEG6000-PIB1000 Copolymer Vesicles. Biomed. Res. Int. 2013 [cited 2022 Apr 26]; 2013 : 1–6. PubMed Abstract | Publisher Full Text | Free Full Text 2. Biswas D, Jiang P: Chemically Induced Reprogramming of Somatic Cells to Pluripotent Stem Cells and Neural Cells. Int. J. Mol. Sci. 2016 Feb 6 [cited 2022 Apr 26]; 17 (2): 226. PubMed Abstract | Publisher Full Text | Free Full Text Reference Source 3. Fukushima K, Liu S, Wu H, et al. : Supramolecular high-aspect ratio assemblies with strong antifungal activity. Nat. Commun. 2013 Dec 9 [cited 2022 Mar 4]; 4 (1): 1–9. Reference Source 4. Madani F, Gräslund A: Membrane Molecular Interactions and Induced Structures of CPPs. Methods Mol. Biol. 2022 [cited 2022 Apr 27]; 2383 : 153–165. PubMed Abstract | Publisher Full Text 5. Schmidt N, Mishra A, Lai GH, et al. : Arginine-rich cell-penetrating peptides. FEBS Lett. 2010 May [cited 2022 Mar 16]; 584 (9): 1806–1813. Publisher Full Text Reference Source 6. Kaishima M, Ishii J, Matsuno T, et al. : Expression of varied GFPs in Saccharomyces cerevisiae: codon optimization yields stronger than expected expression and fluorescence intensity. Sci Rep. 2016 Oct 26 [cited 2022 Apr 26]; 6 (1): 1–15. Reference Source 7. Abyadeh M, Karimi Zarchi AA, Faramarzi MA, et al. : Evaluation of Factors Affecting Size and Size Distribution of Chitosan-Electrosprayed Nanoparticles. Avicenna J. Med. Biotechnol. 2017 [cited 2022 Apr 27]; 9 (3): 126–132. PubMed Abstract | Free Full Text 8. Gietz RD, Schiestl RH: High-efficiency yeast transformation using the LiAc/SS carrier DNA/PEG method. Nat. Protoc. 2007 Feb [cited 2022 Apr 27]; 2 (1): 31–34. PubMed Abstract | Publisher Full Text 9. Iqbal J: Western Blot: Proteins Separating Technique, Protocol, Theory and Trouble Shooting. J. Bacteriol. Mycol. Open Access [Internet]. 2017 Mar 8 [cited 2024 Oct 2]; 4 (2). Reference Source 10. Wibowo S, Widyarti S, Sabarudin A, et al. : DFT and molecular dynamics studies of astaxanthin-metal ions (Cu2+ and Zn2+) complex to prevent glycated human serum albumin from possible unfolding. Heliyon. 2021 Mar 1; 7 (3): e06548. PubMed Abstract | Publisher Full Text | Free Full Text 11. Wibowo S, Costa J, Baratto MC, et al. : Quantification and Improvement of the Dynamics of Human Serum Albumin and Glycated Human Serum Albumin with Astaxanthin/Astaxanthin-Metal Ion Complexes: Physico-Chemical and Computational Approaches.Int. J. Mol. Sci [Internet].2022 May 1 [cited 2024 Oct 2]; 23 (9): 4771. Publisher Full Text 12. Marcelino AMC, Gierasch LM: Roles of β-Turns in Protein Folding: From Peptide Models to Protein Engineering.Biopolymers [Internet].2008 May [cited 2024 Oct 2]; 89 (5): 380–391. PubMed Abstract | Publisher Full Text | Free Full Text 13. Lyu SK, Kwon H: Preparation of cell-permeable Cre recombinase by expressed protein ligation. BMC Biotechnol. 2015 Feb 19 [cited 2022 Apr 26]; 15 (1): 7–9. PubMed Abstract | Publisher Full Text | Free Full Text 14. Nakase I, Noguchi K, Aoki A, et al. : Arginine-rich cell-penetrating peptide-modified extracellular vesicles for active macropinocytosis induction and efficient intracellular delivery. Sci. Rep. 2017 Dec; 7 (1): 1991. PubMed Abstract | Publisher Full Text | Free Full Text 15. Afzal-Javan F, Mobini-Dehkordi M: Amplification, Sequencing and Cloning of Iranian Native Bacillus subtilis Alpha-amylase Gene in Saccharomyces cerevisiae. Jundishapur J. Microbiol. 2013 Oct 1 [cited 2022 Apr 26]; 6 (8): 7371. Reference Source 16. Guaragnella N, Ždralević M, Lattanzio P, et al. : Yeast growth in raffinose results in resistance to acetic-acid induced programmed cell death mostly due to the activation of the mitochondrial retrograde pathway. Biochim. Biophys. Acta, Mol. Cell Res. 2013 Dec 1; 1833 (12): 2765–2774. PubMed Abstract | Publisher Full Text 17. Namba S, Kato H, Shigenobu S, et al. : Massive expression of cysteine-containing proteins causes abnormal elongation of yeast cells by perturbing the proteasome. G3 Genes|Genomes|Genetics [Internet]. 2022 May 30 [cited 2024 Mar 11]; 12 (6). Publisher Full Text 18. Kintaka R, Makanae K, Moriya H: Cellular growth defects triggered by an overload of protein localization processes. Sci. Rep. 2016 Aug 19 [cited 2024 Mar 11]; 6 (1): 1–11. Reference Source 19. Kriachkov V, Ormsby AR, Kusnadi EP, et al. : Arginine-rich C9ORF72 ALS proteins stall ribosomes in a manner distinct from a canonical ribosome-associated quality control substrate. J. Biol. Chem [Internet]. 2023 Jan 1 [cited 2024 Mar 11]; 299 (1). PubMed Abstract 20. Rossi M, Scheffler M, Blum V: Impact of vibrational entropy on the stability of unsolvated peptide helices with increasing length.J. Phys. Chem. B [Internet].2013 May 9 [cited 2024 Oct 3]; 117 (18): 5574–84. PubMed Abstract | Publisher Full Text 21. Vazdar M, Wernersson E, Khabiri M, et al. : Aggregation of oligoarginines at phospholipid membranes: molecular dynamics simulations, time-dependent fluorescence shift, and biomimetic colorimetric assays.J Phys Chem B [Internet].2013 Oct 3 [cited 2024 Oct 2]; 117 (39): 11530–11540. PubMed Abstract | Publisher Full Text 22. Steinbrecher T, Zhu C, Wang L, et al. : Predicting the Effect of Amino Acid Single-Point Mutations on Protein Stability-Large-Scale Validation of MD-Based Relative Free Energy Calculations.J. Mol. Biol [Internet].2017 Apr 7 [cited 2024 Oct 2]; 429 (7): 948–963. PubMed Abstract | Publisher Full Text 23. Magliery TJ: Protein stability: computation, sequence statistics, and new experimental methods.Curr. Opin. Struct. Biol [Internet].2015 Aug 1 [cited 2024 Oct 2]; 33 : 161–168. PubMed Abstract | Publisher Full Text | Free Full Text 24. Tokuriki N, Stricher F, Schymkowitz J, et al. : The stability effects of protein mutations appear to be universally distributed.J. Mol. Biol [Internet].2007 Jun 22 [cited 2024 Sep 26]; 369 (5): 1318–1332. PubMed Abstract | Publisher Full Text 25. Saputro SST, Wahyunita K, Nurhasanah A, et al. : Growth Curve Optical Density of Sacharomyces cerevisiae wild-type, EGFP vector insertion and EGFP PolyR insertion.csv. figshare. Dataset. 2022. Publisher Full Text 26. Saputro SST, Wahyunita K, Nurhasanah A, et al. : The fluorescence of Saccharomyces cerevisiae without transformation and with transformation (pYES2CT- EGFP/ EGFP plasmid, pYES2CT-EGFP- PolyR/EGFP Polyarginine plasmid) at OD 600 on 48 hours. figshare. Dataset. 2022. Publisher Full Text 27. Saputro SST, Wahyunita K, Nurhasanah A, et al. : Figure 1-7. figshare. Figure.2024. Publisher Full Text 28. Saputro SST, Wahyunita K, Nurhasanah A, et al. : Attachment. figshare. Figure.2022. Publisher Full Text Comments on this article Comments (0) Version 3 VERSION 3 PUBLISHED 03 Jan 2023 ADD YOUR COMMENT Comment Author details Author details 1 Department of Biotechnology, Faculty of Biotechnology, Atma Jaya Catholic University of Indonesia, Tangerang, Jakarta Selatan, 15345, Indonesia 2 Centre for Vaccine and Drug Research, National Research and Innovation Agency Republic of Indonesia, Kawasan Puspiptek Serpong, Serpong, 15314, Indonesia 3 Research Centre of Molecular Biology Eijkman, National Reseach and Innovation Agency Republic of Indonesia, Kawasan Sains Teknologi Soekarno, Cibinong, 16911, Indonesia 4 National Reseach and Innovation Agency Republic of Indonesia, Jakarta, Jakarta Pusat, 10340, Indonesia 5 Stem Cell and Tissue Engineering Research Center, Universitas Pembangunan Nasional Veteran Jakarta, Jakarta, Jakarta Selatan, 12450, Indonesia 6 Medical Faculty, Universitas Pembangunan Nasioinal Veteran Jakarta, Jakarta, Jakarta Selatan, 12450, Indonesia Shania Safera Tandio Saputro Roles: Investigation, Methodology, Project Administration, Software, Writing – Original Draft Preparation Khayu Wahyunita Roles: Investigation, Methodology, Validation, Writing – Original Draft Preparation Astutiati Nurhasanah Roles: Investigation, Methodology, Project Administration, Supervision, Validation, Writing – Original Draft Preparation Yudhi Nugraha Roles: Conceptualization, Formal Analysis, Funding Acquisition, Investigation, Methodology, Supervision, Validation, Visualization, Writing – Original Draft Preparation Irvan Faizal Roles: Methodology, Validation Sabar Pambudi Roles: Conceptualization, Data Curation, Formal Analysis, Investigation, Methodology Syahputra Wibowo Roles: Formal Analysis, Visualization, Writing – Original Draft Preparation, Writing – Review & Editing Andri Pramesyanti Pramono Roles: Conceptualization, Formal Analysis, Funding Acquisition, Investigation, Methodology, Supervision, Validation, Visualization, Writing – Original Draft Preparation, Writing – Review & Editing Competing interests No competing interests were disclosed. Grant information The works were financially supported by the Universitas Pembangunan Nasional Veteran Jakarta, (Contract Nr. 001/UN.61.4/2020 and Nr. 001/UN.61.4/2021) DRPM Grant from Kemendikbud. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript. Article Versions (3) version 3 Revised Published: 25 Nov 2024, 12:1 https://doi.org/10.12688/f1000research.123181.3 version 2 Revised Published: 27 Mar 2024, 12:1 https://doi.org/10.12688/f1000research.123181.2 version 1 Published: 03 Jan 2023, 12:1 https://doi.org/10.12688/f1000research.123181.1 Copyright © 2024 Tandio Saputro SS et al . This is an open access article distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Download Export To Sciwheel Bibtex EndNote ProCite Ref. Manager (RIS) Sente metrics Views Downloads F1000Research - - PubMed Central info_outline Data from PMC are received and updated monthly. - - Citations open_in_new 0 open_in_new 0 open_in_new SEE MORE DETAILS CITE how to cite this article Tandio Saputro SS, Wahyunita K, Nurhasanah A et al. Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.12688/f1000research.123181.3 ) NOTE: If applicable, it is important to ensure the information in square brackets after the title is included in all citations of this article. COPY CITATION DETAILS track receive updates on this article Track an article to receive email alerts on any updates to this article. TRACK THIS ARTICLE Share Open Peer Review Current Reviewer Status: ? Key to Reviewer Statuses VIEW HIDE Approved The paper is scientifically sound in its current form and only minor, if any, improvements are suggested Approved with reservations A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit. Not approved Fundamental flaws in the paper seriously undermine the findings and conclusions Version 3 VERSION 3 PUBLISHED 25 Nov 2024 Revised Views 0 Cite How to cite this report: Perrine-Walker FM. Reviewer Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.172954.r360640 ) The direct URL for this report is: https://f1000research.com/articles/12-1/v3#referee-response-360640 NOTE: it is important to ensure the information in square brackets after the title is included in this citation. Close Copy Citation Details Reviewer Report 19 Feb 2025 Francine M Perrine-Walker , The University of Sydney, Sydney, New South Wales, Australia Not Approved VIEWS 0 https://doi.org/10.5256/f1000research.172954.r360640 The manuscript by Tandio Saputro and colleagues titled ‘Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1’ investigated how the reporter, Green Fluorescent Protein (EGFP) could be structurally modified by tagging it with ... Continue reading READ ALL The manuscript by Tandio Saputro and colleagues titled ‘Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1’ investigated how the reporter, Green Fluorescent Protein (EGFP) could be structurally modified by tagging it with eleven arginine residues (PolyR) and monitor how the protein stability and expression levels were affected by this structural change compared to EGFP. In silico studies and western blots were also used to demonstrate how such modifications not only affected the reporter protein’s structure but also had a negative effect on protein detectability and purification. The paper would be of interest to many readers especially those who use protein fluorescence tags. However, the paper does not provide a strong argument as to why it is important to understand polyR in the context of protein expression in cells or perhaps protein expression at the cell membrane surface. Here are some suggestions to improve the paper addressing Partly comments (shown above) 1. for keywords please replace Saccharomyces cerevisiae INVSc1 protein expression, EGFP protein as they are already in the title. Other keywords could be used to increase the chances of the paper being seen by readers. 2. for figure 2, in Lane M, GeneRuler 1kb DNA Ladder was used. It would be helpful to have the sizes of the bands. Please use this website as a guide: https://tinyurl.com/23b9rufk 3. for culturing the yeast and E. coli transformants, were any antibiotics used etc. please state in the legend or in the method section. 4. for figure 5A. Though it was mentioned that images were taken at x40 with Zeiss Axiovert 40 CFL. Was there any possibility to observe the cells at a higher magnification? Or use oil at X100 objective? Please add a scale bar or mention the total magnification used in the legend. What camera or image software was used for this section. Please mention in the method section. Do you think that fixing the cells for 30 minutes could have affected the GFP signal observed? This paper could be useful https://doi.org/10.2144/000113872 . Any live images taken at high magnification? As the authors had both EGFP and EGFP-PolyR in E. coli , did you observe similar expression patterns in E. coli under the microscope etc? 5. these references could be useful to improve the discussion section and to provide some evidence as to why these studies could be useful a. Fuchs SM.et.al; 2005 (Ref 1) b. Fenton D.et.al; 2020 (Ref 2) c. Le et al; 2022 (Ref 3) For the discussion perhaps – the focus could be on yeast as a eukaryotic cell instead of a mammalian cell. The authors could provide a model of what they think the PolyR is doing and how is affecting GFP signal in the yeast cell or at the cell membrane as a final figure for the discussion section. Is the work clearly and accurately presented and does it cite the current literature? Partly Is the study design appropriate and is the work technically sound? Partly Are sufficient details of methods and analysis provided to allow replication by others? Partly If applicable, is the statistical analysis and its interpretation appropriate? I cannot comment. A qualified statistician is required. Are all the source data underlying the results available to ensure full reproducibility? Yes Are the conclusions drawn adequately supported by the results? Partly References 1. Fuchs SM, Raines RT: Polyarginine as a multifunctional fusion tag. Protein Sci . 2005; 14 (6): 1538-44 PubMed Abstract | Publisher Full Text 2. Fenton D, Phillips D, Maddison A, H George C, et al.: Cupid, a cell permeable peptide derived from amoeba, capable of delivering GFP into a diverse range of species. Sci Rep . 2020; 10 (1): 13725 PubMed Abstract | Publisher Full Text 3. Le NTP, Phan TTP, Phan HTT, Truong TTT, et al.: Influence of N-terminal His-tags on the production of recombinant proteins in the cytoplasm of Bacillus subtilis. Biotechnol Rep (Amst) . 2022; 35 : e00754 PubMed Abstract | Publisher Full Text Competing Interests: No competing interests were disclosed. Reviewer Expertise: Yeast, molecular biology, cell biology, plant science, plant-microbe interactions I confirm that I have read this submission and believe that I have an appropriate level of expertise to state that I do not consider it to be of an acceptable scientific standard, for reasons outlined above. Close READ LESS CITE CITE HOW TO CITE THIS REPORT Perrine-Walker FM. Reviewer Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.172954.r360640 ) The direct URL for this report is: https://f1000research.com/articles/12-1/v3#referee-response-360640 NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article. COPY CITATION DETAILS Report a concern Respond or Comment COMMENT ON THIS REPORT Views 0 Cite How to cite this report: Guyot S. Reviewer Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.172954.r343340 ) The direct URL for this report is: https://f1000research.com/articles/12-1/v3#referee-response-343340 NOTE: it is important to ensure the information in square brackets after the title is included in this citation. Close Copy Citation Details Reviewer Report 14 Dec 2024 Stéphane Guyot , UMR Procédés Alimentaires et Microbiologiques, L'Institut Agro Dijon, Dijon, Bourgogne-Franche-Comté, France Not Approved VIEWS 0 https://doi.org/10.5256/f1000research.172954.r343340 The new comments are presented in bold and are based on the previous report and the new version of the paper. In light of the new version of the paper with tracked changes and no direct response to the comments ... Continue reading READ ALL The new comments are presented in bold and are based on the previous report and the new version of the paper. In light of the new version of the paper with tracked changes and no direct response to the comments (except a summary of the changes), I have numbered the lines to assist the authors in linking my comments to the paper's content. I have numbered the first line as the line with the introduction word, then the lines where they are numbered continuously. This method is not conducive to enabling the reviewer to understand why some comments were not (or partly) taken into account, as debate and challenges are integral to the scientific process. The main aim of this paper is to propose a method for expressing a EGFP carrying C-terminal PolyR plus 6xHis-tag in the diploid Saccharomyces cerevisiae INVSc1 strain. Such an engineering approach is proposed to study and improve the transduction process that can be used for cell reprogramming to produce pluripotent stem cells. In general, the paper presents the different stages of yeast transformation by insertion of an appropriately modified plasmid, the effect of the presence of EGFP flanked or not by a PolyR sequence on yeast growth and a protein structure prediction of the EGFP tagged or not with PolyR and 6xHis tag. At this stage, there may be room for improvement in the paper. Some suggestions for enhancements are presented below for your consideration. Major comment 1) My main concern is the functionality of the proteins expressed in Saccharomyces cerevisiae . It is also a question of looking beyond the main objective of this study, which is to optimize the expression of these proteins. Although it would be tedious to carry out an experimental approach involving the cultivation of animal or human cells, I think that in the context of this study it would be interesting to ask whether post-translational modifications made by yeast, which cannot be detected by Western blotting, alter the desired functionality of modified EGFP (PolyR with or without 6xHis-tag) without affecting its fluorescence properties? To validate the present study, it would be advisable to extract the modified EGFP protein, bring it into contact with a human cell, and monitor its internalization (protein transduction) by fluorescence microscopy. New comment: the functionality of the tagged EGFP has yet to be evaluated, which serves to reinforce the interest in this study. Introduction section 2) From my point of view, the introductory section could be improved by not focusing only on one application based on stem cells, since there are a wide range of applications related to the use of protein transduction in various fields such as therapeutic delivery (drug and gene therapy), molecular biology research, regenerative medicine (stem cell engineering and tissue repair), vaccine development, diagnostics, and neuroscience. New Comment: This section has been improved. I don't understand why the 6xHis tag is not mentioned at the end of the section (lines 33-40). Please mention it as you did in the abstract. Methods section 3) Centrifugation steps: Please indicate the relative centrifugal force (x g) rather than the revolutions per minute (in rpm) throughout the paper. New comment: not done. 4) Fluorescent Microscopy: Please clarify why yeasts were fixed with formaldehyde and not observed under a living state. Please indicate the version of the ImageJ software and the plugins utilized for the measurement of fluorescence intensity. As the distribution of fluorescence intensity is not uniform throughout the yeast, it is necessary to specify how the analysis was conducted. In particular, it is important to ascertain which pixels were taken into account. Please clarify whether the ratio of fluorescence intensity to yeast was taken into account. Please indicate the number of cells that were counted. The optimal approach is to conduct an analysis at the single-cell level to illustrate the distribution frequency of fluorescence intensity across the entire yeast population. This methodology enables the observation and subsequent discussion of the heterogeneity in EGFP expression. New comment: not done. 5) Western Blotting: Please explain why SDS-PAGE was selected over native electrophoresis for detecting EGFP, given that it is a fluorescent protein. In light of this approach, the inclusion of an additional 6xHis-tag is unwarranted. New comment: not done. New remark: lines 181-197, two new sub-sections were added at the end of the Materials and Methods section. The date on which the site was visited must be specified. Results section 6) Figure 2: Please indicate the molecular weight of each lane from the DNA ladder. New comment: molecular weight are given in B and C, but no information was given in A and D. 7) The data obtained with the empty plasmid are missing from Figures 3, 4, 5, and 6. This control procedure is essential for evaluating the impact of plasmid presence on yeast behavior. New comment: not done. 8) Figure 4: Title: Saccharomyces cerevisiae must be written in italics New comment: line 258 not done. It should be easier for the reader to specify the lag time, the growth rate and the OD 600 max for each growth curve. It is possible to employ an online software such as Sym’Previus (https://symprevius.eu/en/), to calculate these parameters for each replicate and subsequently perform a statistical analysis. New comment: not done. Line 267: please correct the word “fluresens” 9) Figure 5: It is necessary to compare the fluorescence intensity displayed by the mutants of interest with the fluorescence intensity displayed by a reference mutant expressing EGFP to more accurately assess the relevance of the fluorescence intensity (displayed by the mutants of interest). New comment: not done. 10) Bioinformatics analysis: Does the software builds protein structures based on direct energy minimization? New comment: well done. If so, were any additional 3D structures proposed that differ from those shown in the paper? New comment: not done. 11) Figure 7: The proposed format for the legend is not conducive to rapid identification of the various regions within each sticker. It would be beneficial to include a title for each line or column, such as \"EGFP\" and \"PolyR EGFP,\" and consider utilizing a single color for a single region, thereby facilitating direct identification of the regions on each model. For example, it is not readily apparent which regions of the models are associated with the 6xHis-tag of the EGFP-PolyR protein. To facilitate comprehension, it would be beneficial to consider analogous color schemes between Figures 1 and 7. It would be beneficial to include additional information in the figure 7 and 8 legends to assist the reader in comprehending the various figures. Furthermore, the EGFP structure should be annotated as N-terminal and C-terminal. Figure 8: where is the yellow region? Discussion section New comment, line 478: Title of the first new sub-section: Saccharomyces cerevisiae must be written in italics. 12) Section entitled “Modified protein plasmid insertion causes a decrease in the growth curve of S. cerevisiae ”: Please verify the following sentence: \"Adding raffinose to the growth medium of S. cerevisiae can activate the programmed cell death formation of acetic acid.\" Indeed, Guaragnella et al . (2013) demonstrated that yeast cells grown on raffinose exhibited enhanced resistance to acetic acid-induced programmed cell death (PCD). However, this observation does not necessarily imply that PCD was actively triggered in the presence of raffinose. The discussion should be more measured, given that the concentration of raffinose used in the Guaragnella et al . (2013) study was two times higher (2%) than that used in the present study (1%). It is therefore pertinent to inquire whether the activation of the retrograde pathway occurred at a lower concentration of raffinose. To reinforce this point, it would be beneficial to cite relevant papers in the field. New comment: not done. 13) Table 1: It should be noted that the parameters presented in this table are not discussed in the paper. One might inquire, for instance, how the charges of EGFP and EGFP-PolyR are affected by the intracellular pH in yeast in relation to their pI. It would be beneficial to ascertain whether there are any consequences on EGFP aggregation and fluorescence, for example. For further insight, please consult the following paper, which will enhance the quality of the discussion: Nathalia Vieira dos Santos, Carolina Falaschi Saponi, Timothy M. Ryan, Fernando L. Primo, Tamar L. Greaves, Jorge F.B. Pereira. Reversible and irreversible fluorescence activity of the Enhanced Green Fluorescent Protein in pH: Insights for the development of pH-biosensors. International Journal of Biological Macromolecules, Volume 164, 2020, Pages 3474-3484. Complementary papers about intracellular pH in yeast could be found to reinforce the discussion. New comment: not done. It would be beneficial for the reader to highlight the different regions of the protein sequences with varying colors (see comment 9). Furthermore, providing additional information about the sequence situated between the EGFP and 6xHis-tag in the EGFP sequence (EFCRYPAQWRPLESRGPFEGKPIPNPLLGLDSTRT) and the sequence between the EGFP and PolyR-6xHis-tag sequences in the EGFP-PolyR sequence (EFESGGGGSPG) would be beneficial. Why did the authors consider these two different “linkers”? New comment: not done. 14) The discussion about the effect of the presence of the EGFP on growth could be enhanced by considering the implementation of supplementary experiments with the objective of elucidating its impact on specific physiological characteristics, such as mitochondrial and metabolic activities. The utilization of fluorescent microscopy (or flow cytometry) in conjunction with suitable fluorescent probes could be a viable avenue for exploration. New comment: not done. Competing Interests: No competing interests were disclosed. Reviewer Expertise: Yeast engineering, GFP expression in yeast, fluorescence microscopy, microbial growth, biochemistry, microbial food processes I confirm that I have read this submission and believe that I have an appropriate level of expertise to state that I do not consider it to be of an acceptable scientific standard, for reasons outlined above. Close READ LESS CITE CITE HOW TO CITE THIS REPORT Guyot S. Reviewer Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.172954.r343340 ) The direct URL for this report is: https://f1000research.com/articles/12-1/v3#referee-response-343340 NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article. COPY CITATION DETAILS Report a concern Respond or Comment COMMENT ON THIS REPORT Version 2 VERSION 2 PUBLISHED 27 Mar 2024 Revised Views 0 Cite How to cite this report: Huang Y. Reviewer Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.163692.r300366 ) The direct URL for this report is: https://f1000research.com/articles/12-1/v2#referee-response-300366 NOTE: it is important to ensure the information in square brackets after the title is included in this citation. Close Copy Citation Details Reviewer Report 24 Jul 2024 Yide Huang , Fujian Normal University, Fuzhou, Fujian, China Not Approved VIEWS 0 https://doi.org/10.5256/f1000research.163692.r300366 The authors attempted to express EGFP and EGFP-polyR proteins with a 6×His tag in Saccharomyces cerevisiae for subsequent protein transduction studies. They synthesized EGFP and EGFP-polyR sequences, cloned them into the S. cerevisiae expression vector pYES2CT, and introduced the ... Continue reading READ ALL The authors attempted to express EGFP and EGFP-polyR proteins with a 6×His tag in Saccharomyces cerevisiae for subsequent protein transduction studies. They synthesized EGFP and EGFP-polyR sequences, cloned them into the S. cerevisiae expression vector pYES2CT, and introduced the vector into the yeast S. cerevisiae INVSc1 to achieve the expression of EGFP and EGFP-polyR. However, there are several issues with the manuscript: 1. Figure 1 shows the process of constructing recombinant plasmids, which is part of the methods section, not the results. It is recommended to move it to the methods section under \"Plasmid design and construction.\" 2. The title of the figure legend should provide a summary description of the figure, not a description of the methods. 3. For Figure 4, it is recommended to combine panels A, B, and C into one figure and perform statistical comparisons. This will make it clearer for readers to distinguish the differences. Figure 4D is just another presentation of panels A, B, and C and constitutes redundant data, so it should be removed. 4. In Figure 5, the EGFP intensity observed in panel A at 72 hours is much stronger in the EGFP vector group compared to the EGFP-PolyA vector group. However, the quantitative results in panel B show no difference, indicating that the quantification method used in the manuscript is not accurate. It is suggested to use flow cytometry for detection and quantitative analysis. 5. The authors analyzed the expression of EGFP and EGFP-polyR in the yeast cells using Western blot. However, no distinct bands were observed, and the signal above the expected target band appears diffuse, likely due to non-specific binding of the His-tag antibody. Since EGFP antibodies are more specific than His-tag antibodies, it is recommended to use EGFP antibodies for detection. 6. There are still some mistypes in the manuscript that need to be corrected. Is the work clearly and accurately presented and does it cite the current literature? Partly Is the study design appropriate and is the work technically sound? Partly Are sufficient details of methods and analysis provided to allow replication by others? Yes If applicable, is the statistical analysis and its interpretation appropriate? Not applicable Are all the source data underlying the results available to ensure full reproducibility? Yes Are the conclusions drawn adequately supported by the results? Partly Competing Interests: No competing interests were disclosed. Reviewer Expertise: Pichia pastoris, Recombinant expression, Protein engineering, Applied microbiology I confirm that I have read this submission and believe that I have an appropriate level of expertise to state that I do not consider it to be of an acceptable scientific standard, for reasons outlined above. Close READ LESS CITE CITE HOW TO CITE THIS REPORT Huang Y. Reviewer Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.163692.r300366 ) The direct URL for this report is: https://f1000research.com/articles/12-1/v2#referee-response-300366 NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article. COPY CITATION DETAILS Report a concern Respond or Comment COMMENT ON THIS REPORT Views 0 Cite How to cite this report: Guyot S. Reviewer Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.163692.r300364 ) The direct URL for this report is: https://f1000research.com/articles/12-1/v2#referee-response-300364 NOTE: it is important to ensure the information in square brackets after the title is included in this citation. Close Copy Citation Details Reviewer Report 23 Jul 2024 Stéphane Guyot , UMR Procédés Alimentaires et Microbiologiques, L'Institut Agro Dijon, Dijon, Bourgogne-Franche-Comté, France Not Approved VIEWS 0 https://doi.org/10.5256/f1000research.163692.r300364 The main aim of this paper is to propose a method for expressing a EGFP carrying C-terminal PolyR plus 6xHis-tag in the diploid Saccharomyces cerevisiae INVSc1 strain. Such an engineering approach is proposed to study and improve the transduction process ... Continue reading READ ALL The main aim of this paper is to propose a method for expressing a EGFP carrying C-terminal PolyR plus 6xHis-tag in the diploid Saccharomyces cerevisiae INVSc1 strain. Such an engineering approach is proposed to study and improve the transduction process that can be used for cell reprogramming to produce pluripotent stem cells. In general, the paper presents the different stages of yeast transformation by insertion of an appropriately modified plasmid, the effect of the presence of EGFP flanked or not by a PolyR sequence on yeast growth and a protein structure prediction of the EGFP tagged or not with PolyR and 6xHis tag. At this stage, there may be room for improvement in the paper. Some suggestions for enhancements are presented below for your consideration. Major comment 1) My main concern is the functionality of the proteins expressed in Saccharomyces cerevisiae . It is also a question of looking beyond the main objective of this study, which is to optimize the expression of these proteins. Although it would be tedious to carry out an experimental approach involving the cultivation of animal or human cells, I think that in the context of this study it would be interesting to ask whether post-translational modifications made by yeast, which cannot be detected by Western blotting, alter the desired functionality of modified EGFP (PolyR with or without 6xHis-tag) without affecting its fluorescence properties? To validate the present study, it would be advisable to extract the modified EGFP protein, bring it into contact with a human cell, and monitor its internalization (protein transduction) by fluorescence microscopy. Introduction section 2) From my point of view, the introductory section could be improved by not focusing only on one application based on stem cells, since there are a wide range of applications related to the use of protein transduction in various fields such as therapeutic delivery (drug and gene therapy), molecular biology research, regenerative medicine (stem cell engineering and tissue repair), vaccine development, diagnostics, and neuroscience. Methods section 3) Centrifugation steps: Please indicate the relative centrifugal force (x g) rather than the revolutions per minute (in rpm) throughout the paper. 4) Fluorescent Microscopy: Please clarify why yeasts were fixed with formaldehyde and not observed under a living state. Please indicate the version of the ImageJ software and the plugins utilized for the measurement of fluorescence intensity. As the distribution of fluorescence intensity is not uniform throughout the yeast, it is necessary to specify how the analysis was conducted. In particular, it is important to ascertain which pixels were taken into account. Please clarify whether the ratio of fluorescence intensity to yeast was taken into account. Please indicate the number of cells that were counted. The optimal approach is to conduct an analysis at the single-cell level to illustrate the distribution frequency of fluorescence intensity across the entire yeast population. This methodology enables the observation and subsequent discussion of the heterogeneity in EGFP expression. 5) Western Blotting: Please explain why SDS-PAGE was selected over native electrophoresis for detecting EGFP, given that it is a fluorescent protein. In light of this approach, the inclusion of an additional 6xHis-tag is unwarranted. Results section 6) Figure 2: Please indicate the molecular weight of each lane from the DNA ladder. 7) The data obtained with the empty plasmid are missing from Figures 3, 4, 5, and 6. This control procedure is essential for evaluating the impact of plasmid presence on yeast behavior. 8) Figure 4: Title: Saccharomyces cerevisiae should be written with in italics It should be easier for the reader to specify the lag time, the growth rate and the OD 600 max for each growth curve. It is possible to employ an online software such as Sym’Previus (https://symprevius.eu/en/), to calculate these parameters for each replicate and subsequently perform a statistical analysis. 9) Figure 5: It is necessary to compare the fluorescence intensity displayed by the mutants of interest with the fluorescence intensity displayed by a reference mutant expressing EGFP to more accurately assess the relevance of the fluorescence intensity (displayed by the mutants of interest). 10) Bioinformatics analysis: Does the software builds protein structures based on direct energy minimization? If so, were any additional 3D structures proposed that differ from those shown in the paper? 11) Figure 7: The proposed format for the legend is not conducive to rapid identification of the various regions within each sticker. It would be beneficial to include a title for each line or column, such as \"EGFP\" and \"PolyR EGFP,\" and consider utilizing a single color for a single region, thereby facilitating direct identification of the regions on each model. For example, it is not readily apparent which regions of the models are associated with the 6xHis-tag of the EGFP-PolyR protein. To facilitate comprehension, it would be beneficial to consider analogous color schemes between Figures 1 and 7. Discussion section 12) Section entitled “Modified protein plasmid insertion causes a decrease in the growth curve of S. cerevisiae ”: Please verify the following sentence: \"Adding raffinose to the growth medium of S. cerevisiae can activate the programmed cell death formation of acetic acid.\" Indeed, Guaragnella et al . (2013) demonstrated that yeast cells grown on raffinose exhibited enhanced resistance to acetic acid-induced programmed cell death (PCD). However, this observation does not necessarily imply that PCD was actively triggered in the presence of raffinose. The discussion should be more measured, given that the concentration of raffinose used in the Guaragnella et al . (2013) study was two times higher (2%) than that used in the present study (1%). It is therefore pertinent to inquire whether the activation of the retrograde pathway occurred at a lower concentration of raffinose. To reinforce this point, it would be beneficial to cite relevant papers in the field. 13) Table 1: It should be noted that the parameters presented in this table are not discussed in the paper. One might inquire, for instance, how the charges of EGFP and EGFP-PolyR are affected by the intracellular pH in yeast in relation to their pI. It would be beneficial to ascertain whether there are any consequences on EGFP aggregation and fluorescence, for example. For further insight, please consult the following paper, which will enhance the quality of the discussion: Nathalia Vieira dos Santos, Carolina Falaschi Saponi, Timothy M. Ryan, Fernando L. Primo, Tamar L. Greaves, Jorge F.B. Pereira. Reversible and irreversible fluorescence activity of the Enhanced Green Fluorescent Protein in pH: Insights for the development of pH-biosensors. International Journal of Biological Macromolecules, Volume 164, 2020, Pages 3474-3484. Complementary papers about intracellular pH in yeast could be found to reinforce the discussion. It would be beneficial for the reader to highlight the different regions of the protein sequences with varying colors (see comment 9). Furthermore, providing additional information about the sequence situated between the EGFP and 6xHis-tag in the EGFP sequence (EFCRYPAQWRPLESRGPFEGKPIPNPLLGLDSTRT) and the sequence between the EGFP and PolyR-6xHis-tag sequences in the EGFP-PolyR sequence (EFESGGGGSPG) would be beneficial. Why did the authors consider these two different “linkers”? 14) The discussion about the effect of the presence of the EGFP on growth could be enhanced by considering the implementation of supplementary experiments with the objective of elucidating its impact on specific physiological characteristics, such as mitochondrial and metabolic activities. The utilization of fluorescent microscopy (or flow cytometry) in conjunction with suitable fluorescent probes could be a viable avenue for exploration. Is the work clearly and accurately presented and does it cite the current literature? Partly Is the study design appropriate and is the work technically sound? Partly Are sufficient details of methods and analysis provided to allow replication by others? Partly If applicable, is the statistical analysis and its interpretation appropriate? Partly Are all the source data underlying the results available to ensure full reproducibility? Partly Are the conclusions drawn adequately supported by the results? Partly References 1. Dos Santos NV, Saponi CF, Ryan TM, Primo FL, et al.: Reversible and irreversible fluorescence activity of the Enhanced Green Fluorescent Protein in pH: Insights for the development of pH-biosensors. Int J Biol Macromol . 2020; 164 : 3474-3484 PubMed Abstract | Publisher Full Text Competing Interests: No competing interests were disclosed. Reviewer Expertise: Yeast engineering, GFP expression in yeast, fluorescence microscopy, microbial growth, biochemistry, microbial food processes I confirm that I have read this submission and believe that I have an appropriate level of expertise to state that I do not consider it to be of an acceptable scientific standard, for reasons outlined above. Close READ LESS CITE CITE HOW TO CITE THIS REPORT Guyot S. Reviewer Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.163692.r300364 ) The direct URL for this report is: https://f1000research.com/articles/12-1/v2#referee-response-300364 NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article. COPY CITATION DETAILS Report a concern Respond or Comment COMMENT ON THIS REPORT Version 1 VERSION 1 PUBLISHED 03 Jan 2023 Views 0 Cite How to cite this report: Moriya H. Reviewer Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.135264.r177225 ) The direct URL for this report is: https://f1000research.com/articles/12-1/v1#referee-response-177225 NOTE: it is important to ensure the information in square brackets after the title is included in this citation. Close Copy Citation Details Reviewer Report 06 Nov 2023 Hisao Moriya , Okayama University, Okayama, Japan Not Approved VIEWS 0 https://doi.org/10.5256/f1000research.135264.r177225 In this paper, the authors attempted to express EGFP-polyR in S. cerevisiae . They concluded that EGFP was successfully expressed and that the addition of polyR had no effect on the expression level of EGFP. However, the expression ... Continue reading READ ALL In this paper, the authors attempted to express EGFP-polyR in S. cerevisiae . They concluded that EGFP was successfully expressed and that the addition of polyR had no effect on the expression level of EGFP. However, the expression level of EGFP in S. cerevisiae seems to be much lower than the high expression level we know, and there are many possible improvements. Since many papers have been published on heterologous expression of fluorescent proteins in yeast, the authors should objectively judge how their level of technology compares with them. For example, our gTOW vector system can \"express EGFP to the limit,\" and in that case it can express enough EGFP to be recognized by SDS-PAGE in total protein without Western blotting 1 , 2 . Codon optimization is also mentioned by the authors. On the other hand, most yeast researchers, including us, use yEGFP3, a codon-optimized EGFP that maximizes expression in yeast 3 , which the authors should try first. In addition, for plasmid construction, you may want to consider introducing a strong homologous recombination cloning method, which is available in yeast 4 . Cell disruption by glass beads is also easier and less expensive than spheroplasting in yeast. In our experience, EGFP-his6 can be purified in large quantities with virtually no degradation. In fact, we have been using the above plasmid to express and purify yEGFP-his6 by glass bead disruption as a practical training for students. If necessary, the plasmid can be distributed by us. Finally, polyR is known to stall translation 5 , a finding that may be helpful when trying to express EGFP-polyR after successful mass expression of EGFP. Is the work clearly and accurately presented and does it cite the current literature? No Is the study design appropriate and is the work technically sound? Partly Are sufficient details of methods and analysis provided to allow replication by others? Yes If applicable, is the statistical analysis and its interpretation appropriate? Not applicable Are all the source data underlying the results available to ensure full reproducibility? Yes Are the conclusions drawn adequately supported by the results? Partly References 1. Kintaka R, Makanae K, Moriya H: Cellular growth defects triggered by an overload of protein localization processes. Sci Rep . 2016; 6 : 31774 PubMed Abstract | Publisher Full Text 2. Namba S, Kato H, Shigenobu S, Makino T, et al.: Massive expression of cysteine-containing proteins causes abnormal elongation of yeast cells by perturbing the proteasome. G3 (Bethesda) . 2022; 12 (6). PubMed Abstract | Publisher Full Text 3. Cormack BP, Bertram G, Egerton M, Gow NAR, et al.: Yeast-enhanced green fluorescent protein (yEGFP): a reporter of gene expression in Candida albicans. Microbiology (Reading) . 1997; 143 ( Pt 2) : 303-311 PubMed Abstract | Publisher Full Text 4. Oldenburg KR, Vo KT, Michaelis S, Paddon C: Recombination-mediated PCR-directed plasmid construction in vivo in yeast. Nucleic Acids Res . 1997; 25 (2): 451-2 PubMed Abstract | Publisher Full Text 5. Kriachkov V, Ormsby AR, Kusnadi EP, McWilliam HEG, et al.: Arginine-rich C9ORF72 ALS proteins stall ribosomes in a manner distinct from a canonical ribosome-associated quality control substrate. J Biol Chem . 2023; 299 (1): 102774 PubMed Abstract | Publisher Full Text Competing Interests: No competing interests were disclosed. Reviewer Expertise: Yeast, overexpression, plasmid construction, systems biology I confirm that I have read this submission and believe that I have an appropriate level of expertise to state that I do not consider it to be of an acceptable scientific standard, for reasons outlined above. Close READ LESS CITE CITE HOW TO CITE THIS REPORT Moriya H. Reviewer Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.135264.r177225 ) The direct URL for this report is: https://f1000research.com/articles/12-1/v1#referee-response-177225 NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article. COPY CITATION DETAILS Report a concern Respond or Comment COMMENT ON THIS REPORT Views 0 Cite How to cite this report: Hasan K. Reviewer Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.135264.r159002 ) The direct URL for this report is: https://f1000research.com/articles/12-1/v1#referee-response-159002 NOTE: it is important to ensure the information in square brackets after the title is included in this citation. Close Copy Citation Details Reviewer Report 03 Nov 2023 Khomaini Hasan , Faculty of Medicine, Universitas Jenderal Achmad Yani, Cimahi, Indonesia Not Approved VIEWS 0 https://doi.org/10.5256/f1000research.135264.r159002 Pramono and Co-workers study on expression of recombinant Enhanced Green Fluorescent Protein (EGFP) with some modification with the addition of poly-R in order to help protein penetration within cells. In general, the work can be significantly improved, especially in terms ... Continue reading READ ALL Pramono and Co-workers study on expression of recombinant Enhanced Green Fluorescent Protein (EGFP) with some modification with the addition of poly-R in order to help protein penetration within cells. In general, the work can be significantly improved, especially in terms of quality of the data due to lack of evidence that are correlated with the conclusions. First, as we read in the article, Pramono and co-workers were struggling on how to express and obtained the recombinant protein in sufficient amount. Even though, the Western Blot microscopic data which were presented in the manuscript confirms the success of protein expression, but the quality of SDS PAGE gels did not fully support their conclusion. The gel itself lacks some data and low quality, for instance, no clear molecular weight marker and the bands, which were considered as expressed proteins, were almost invisible. Second, the quantitative methodology, which were conducted and presented here, is mostly not effective to be done, because most of them show unexpected results. For instance, when they claimed that the expressed protein was low, they did ultrafiltration with 5 kDa cutoff and resulted no significant improvement. They also failed to prove that additional 6-his-tag in the recombinant protein is useful for their experiment as well. In order to answer our curiosity on the 6-histag, I would suggest to do a protein purification, so the claim of structure model that were presented in the manuscript can be proven and relevant. Third, the claim on the effect of plasmid toward growth of the yeast is weak due to lack of repetition to the experiment. If the experiment is conducted triplicates, the potential bias can be reduced and the issue of reproducibility may not occur. Additionally, the genetic optimization which was conducted computationally are useless due to having no experimental data that support the claim. Fourth, the quality of the figures is very poor in quality. The authors can improve by using a camera or similar equipment that meets the requirement of the quality. Lastly, some mistypes can be prevented. Is the work clearly and accurately presented and does it cite the current literature? Partly Is the study design appropriate and is the work technically sound? Partly Are sufficient details of methods and analysis provided to allow replication by others? Partly If applicable, is the statistical analysis and its interpretation appropriate? Not applicable Are all the source data underlying the results available to ensure full reproducibility? Partly Are the conclusions drawn adequately supported by the results? Partly Competing Interests: No competing interests were disclosed. Reviewer Expertise: Protein chemistry, protein engineering, enzymology, protein therapeutics, biocatalysis and biotransformation I confirm that I have read this submission and believe that I have an appropriate level of expertise to state that I do not consider it to be of an acceptable scientific standard, for reasons outlined above. Close READ LESS CITE CITE HOW TO CITE THIS REPORT Hasan K. Reviewer Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.135264.r159002 ) The direct URL for this report is: https://f1000research.com/articles/12-1/v1#referee-response-159002 NOTE: it is important to ensure the information in square brackets after the title is included in all citations of this article. COPY CITATION DETAILS Report a concern Respond or Comment COMMENT ON THIS REPORT Comments on this article Comments (0) Version 3 VERSION 3 PUBLISHED 03 Jan 2023 ADD YOUR COMMENT Comment keyboard_arrow_left keyboard_arrow_right Open Peer Review Reviewer Status info_outline Alongside their report, reviewers assign a status to the article: Approved The paper is scientifically sound in its current form and only minor, if any, improvements are suggested Approved with reservations A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit. Not approved Fundamental flaws in the paper seriously undermine the findings and conclusions Reviewer Reports Invited Reviewers 1 2 3 4 5 Version 3 (revision) 25 Nov 24 read read Version 2 (revision) 27 Mar 24 read read Version 1 03 Jan 23 read read Khomaini Hasan , Universitas Jenderal Achmad Yani, Cimahi, Indonesia Hisao Moriya , Okayama University, Okayama, Japan Stéphane Guyot , L'Institut Agro Dijon, Dijon, France Yide Huang , Fujian Normal University, Fuzhou, China Francine M Perrine-Walker , The University of Sydney, Sydney, Australia Comments on this article All Comments (0) Add a comment Sign up for content alerts Sign Up You are now signed up to receive this alert Browse by related subjects keyboard_arrow_left Back to all reports Reviewer Report 0 Views copyright © 2025 Perrine-Walker F. This is an open access peer review report distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. 19 Feb 2025 | for Version 3 Francine M Perrine-Walker , The University of Sydney, Sydney, New South Wales, Australia 0 Views copyright © 2025 Perrine-Walker F. This is an open access peer review report distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. format_quote Cite this report speaker_notes Responses (0) Not Approved info_outline Alongside their report, reviewers assign a status to the article: Approved The paper is scientifically sound in its current form and only minor, if any, improvements are suggested Approved with reservations A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit. Not approved Fundamental flaws in the paper seriously undermine the findings and conclusions The manuscript by Tandio Saputro and colleagues titled ‘Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1’ investigated how the reporter, Green Fluorescent Protein (EGFP) could be structurally modified by tagging it with eleven arginine residues (PolyR) and monitor how the protein stability and expression levels were affected by this structural change compared to EGFP. In silico studies and western blots were also used to demonstrate how such modifications not only affected the reporter protein’s structure but also had a negative effect on protein detectability and purification. The paper would be of interest to many readers especially those who use protein fluorescence tags. However, the paper does not provide a strong argument as to why it is important to understand polyR in the context of protein expression in cells or perhaps protein expression at the cell membrane surface. Here are some suggestions to improve the paper addressing Partly comments (shown above) 1. for keywords please replace Saccharomyces cerevisiae INVSc1 protein expression, EGFP protein as they are already in the title. Other keywords could be used to increase the chances of the paper being seen by readers. 2. for figure 2, in Lane M, GeneRuler 1kb DNA Ladder was used. It would be helpful to have the sizes of the bands. Please use this website as a guide: https://tinyurl.com/23b9rufk 3. for culturing the yeast and E. coli transformants, were any antibiotics used etc. please state in the legend or in the method section. 4. for figure 5A. Though it was mentioned that images were taken at x40 with Zeiss Axiovert 40 CFL. Was there any possibility to observe the cells at a higher magnification? Or use oil at X100 objective? Please add a scale bar or mention the total magnification used in the legend. What camera or image software was used for this section. Please mention in the method section. Do you think that fixing the cells for 30 minutes could have affected the GFP signal observed? This paper could be useful https://doi.org/10.2144/000113872 . Any live images taken at high magnification? As the authors had both EGFP and EGFP-PolyR in E. coli , did you observe similar expression patterns in E. coli under the microscope etc? 5. these references could be useful to improve the discussion section and to provide some evidence as to why these studies could be useful a. Fuchs SM.et.al; 2005 (Ref 1) b. Fenton D.et.al; 2020 (Ref 2) c. Le et al; 2022 (Ref 3) For the discussion perhaps – the focus could be on yeast as a eukaryotic cell instead of a mammalian cell. The authors could provide a model of what they think the PolyR is doing and how is affecting GFP signal in the yeast cell or at the cell membrane as a final figure for the discussion section. Is the work clearly and accurately presented and does it cite the current literature? Partly Is the study design appropriate and is the work technically sound? Partly Are sufficient details of methods and analysis provided to allow replication by others? Partly If applicable, is the statistical analysis and its interpretation appropriate? I cannot comment. A qualified statistician is required. Are all the source data underlying the results available to ensure full reproducibility? Yes Are the conclusions drawn adequately supported by the results? Partly References 1. Fuchs SM, Raines RT: Polyarginine as a multifunctional fusion tag. Protein Sci . 2005; 14 (6): 1538-44 PubMed Abstract | Publisher Full Text 2. Fenton D, Phillips D, Maddison A, H George C, et al.: Cupid, a cell permeable peptide derived from amoeba, capable of delivering GFP into a diverse range of species. Sci Rep . 2020; 10 (1): 13725 PubMed Abstract | Publisher Full Text 3. Le NTP, Phan TTP, Phan HTT, Truong TTT, et al.: Influence of N-terminal His-tags on the production of recombinant proteins in the cytoplasm of Bacillus subtilis. Biotechnol Rep (Amst) . 2022; 35 : e00754 PubMed Abstract | Publisher Full Text Competing Interests No competing interests were disclosed. Reviewer Expertise Yeast, molecular biology, cell biology, plant science, plant-microbe interactions I confirm that I have read this submission and believe that I have an appropriate level of expertise to state that I do not consider it to be of an acceptable scientific standard, for reasons outlined above. reply Respond to this report Responses (0) Perrine-Walker FM. Peer Review Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.172954.r360640) NOTE: it is important to ensure the information in square brackets after the title is included in this citation. The direct URL for this report is: https://f1000research.com/articles/12-1/v3#referee-response-360640 keyboard_arrow_left Back to all reports Reviewer Report 0 Views copyright © 2024 Guyot S. This is an open access peer review report distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. 14 Dec 2024 | for Version 3 Stéphane Guyot , UMR Procédés Alimentaires et Microbiologiques, L'Institut Agro Dijon, Dijon, Bourgogne-Franche-Comté, France 0 Views copyright © 2024 Guyot S. This is an open access peer review report distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. format_quote Cite this report speaker_notes Responses (0) Not Approved info_outline Alongside their report, reviewers assign a status to the article: Approved The paper is scientifically sound in its current form and only minor, if any, improvements are suggested Approved with reservations A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit. Not approved Fundamental flaws in the paper seriously undermine the findings and conclusions The new comments are presented in bold and are based on the previous report and the new version of the paper. In light of the new version of the paper with tracked changes and no direct response to the comments (except a summary of the changes), I have numbered the lines to assist the authors in linking my comments to the paper's content. I have numbered the first line as the line with the introduction word, then the lines where they are numbered continuously. This method is not conducive to enabling the reviewer to understand why some comments were not (or partly) taken into account, as debate and challenges are integral to the scientific process. The main aim of this paper is to propose a method for expressing a EGFP carrying C-terminal PolyR plus 6xHis-tag in the diploid Saccharomyces cerevisiae INVSc1 strain. Such an engineering approach is proposed to study and improve the transduction process that can be used for cell reprogramming to produce pluripotent stem cells. In general, the paper presents the different stages of yeast transformation by insertion of an appropriately modified plasmid, the effect of the presence of EGFP flanked or not by a PolyR sequence on yeast growth and a protein structure prediction of the EGFP tagged or not with PolyR and 6xHis tag. At this stage, there may be room for improvement in the paper. Some suggestions for enhancements are presented below for your consideration. Major comment 1) My main concern is the functionality of the proteins expressed in Saccharomyces cerevisiae . It is also a question of looking beyond the main objective of this study, which is to optimize the expression of these proteins. Although it would be tedious to carry out an experimental approach involving the cultivation of animal or human cells, I think that in the context of this study it would be interesting to ask whether post-translational modifications made by yeast, which cannot be detected by Western blotting, alter the desired functionality of modified EGFP (PolyR with or without 6xHis-tag) without affecting its fluorescence properties? To validate the present study, it would be advisable to extract the modified EGFP protein, bring it into contact with a human cell, and monitor its internalization (protein transduction) by fluorescence microscopy. New comment: the functionality of the tagged EGFP has yet to be evaluated, which serves to reinforce the interest in this study. Introduction section 2) From my point of view, the introductory section could be improved by not focusing only on one application based on stem cells, since there are a wide range of applications related to the use of protein transduction in various fields such as therapeutic delivery (drug and gene therapy), molecular biology research, regenerative medicine (stem cell engineering and tissue repair), vaccine development, diagnostics, and neuroscience. New Comment: This section has been improved. I don't understand why the 6xHis tag is not mentioned at the end of the section (lines 33-40). Please mention it as you did in the abstract. Methods section 3) Centrifugation steps: Please indicate the relative centrifugal force (x g) rather than the revolutions per minute (in rpm) throughout the paper. New comment: not done. 4) Fluorescent Microscopy: Please clarify why yeasts were fixed with formaldehyde and not observed under a living state. Please indicate the version of the ImageJ software and the plugins utilized for the measurement of fluorescence intensity. As the distribution of fluorescence intensity is not uniform throughout the yeast, it is necessary to specify how the analysis was conducted. In particular, it is important to ascertain which pixels were taken into account. Please clarify whether the ratio of fluorescence intensity to yeast was taken into account. Please indicate the number of cells that were counted. The optimal approach is to conduct an analysis at the single-cell level to illustrate the distribution frequency of fluorescence intensity across the entire yeast population. This methodology enables the observation and subsequent discussion of the heterogeneity in EGFP expression. New comment: not done. 5) Western Blotting: Please explain why SDS-PAGE was selected over native electrophoresis for detecting EGFP, given that it is a fluorescent protein. In light of this approach, the inclusion of an additional 6xHis-tag is unwarranted. New comment: not done. New remark: lines 181-197, two new sub-sections were added at the end of the Materials and Methods section. The date on which the site was visited must be specified. Results section 6) Figure 2: Please indicate the molecular weight of each lane from the DNA ladder. New comment: molecular weight are given in B and C, but no information was given in A and D. 7) The data obtained with the empty plasmid are missing from Figures 3, 4, 5, and 6. This control procedure is essential for evaluating the impact of plasmid presence on yeast behavior. New comment: not done. 8) Figure 4: Title: Saccharomyces cerevisiae must be written in italics New comment: line 258 not done. It should be easier for the reader to specify the lag time, the growth rate and the OD 600 max for each growth curve. It is possible to employ an online software such as Sym’Previus (https://symprevius.eu/en/), to calculate these parameters for each replicate and subsequently perform a statistical analysis. New comment: not done. Line 267: please correct the word “fluresens” 9) Figure 5: It is necessary to compare the fluorescence intensity displayed by the mutants of interest with the fluorescence intensity displayed by a reference mutant expressing EGFP to more accurately assess the relevance of the fluorescence intensity (displayed by the mutants of interest). New comment: not done. 10) Bioinformatics analysis: Does the software builds protein structures based on direct energy minimization? New comment: well done. If so, were any additional 3D structures proposed that differ from those shown in the paper? New comment: not done. 11) Figure 7: The proposed format for the legend is not conducive to rapid identification of the various regions within each sticker. It would be beneficial to include a title for each line or column, such as \"EGFP\" and \"PolyR EGFP,\" and consider utilizing a single color for a single region, thereby facilitating direct identification of the regions on each model. For example, it is not readily apparent which regions of the models are associated with the 6xHis-tag of the EGFP-PolyR protein. To facilitate comprehension, it would be beneficial to consider analogous color schemes between Figures 1 and 7. It would be beneficial to include additional information in the figure 7 and 8 legends to assist the reader in comprehending the various figures. Furthermore, the EGFP structure should be annotated as N-terminal and C-terminal. Figure 8: where is the yellow region? Discussion section New comment, line 478: Title of the first new sub-section: Saccharomyces cerevisiae must be written in italics. 12) Section entitled “Modified protein plasmid insertion causes a decrease in the growth curve of S. cerevisiae ”: Please verify the following sentence: \"Adding raffinose to the growth medium of S. cerevisiae can activate the programmed cell death formation of acetic acid.\" Indeed, Guaragnella et al . (2013) demonstrated that yeast cells grown on raffinose exhibited enhanced resistance to acetic acid-induced programmed cell death (PCD). However, this observation does not necessarily imply that PCD was actively triggered in the presence of raffinose. The discussion should be more measured, given that the concentration of raffinose used in the Guaragnella et al . (2013) study was two times higher (2%) than that used in the present study (1%). It is therefore pertinent to inquire whether the activation of the retrograde pathway occurred at a lower concentration of raffinose. To reinforce this point, it would be beneficial to cite relevant papers in the field. New comment: not done. 13) Table 1: It should be noted that the parameters presented in this table are not discussed in the paper. One might inquire, for instance, how the charges of EGFP and EGFP-PolyR are affected by the intracellular pH in yeast in relation to their pI. It would be beneficial to ascertain whether there are any consequences on EGFP aggregation and fluorescence, for example. For further insight, please consult the following paper, which will enhance the quality of the discussion: Nathalia Vieira dos Santos, Carolina Falaschi Saponi, Timothy M. Ryan, Fernando L. Primo, Tamar L. Greaves, Jorge F.B. Pereira. Reversible and irreversible fluorescence activity of the Enhanced Green Fluorescent Protein in pH: Insights for the development of pH-biosensors. International Journal of Biological Macromolecules, Volume 164, 2020, Pages 3474-3484. Complementary papers about intracellular pH in yeast could be found to reinforce the discussion. New comment: not done. It would be beneficial for the reader to highlight the different regions of the protein sequences with varying colors (see comment 9). Furthermore, providing additional information about the sequence situated between the EGFP and 6xHis-tag in the EGFP sequence (EFCRYPAQWRPLESRGPFEGKPIPNPLLGLDSTRT) and the sequence between the EGFP and PolyR-6xHis-tag sequences in the EGFP-PolyR sequence (EFESGGGGSPG) would be beneficial. Why did the authors consider these two different “linkers”? New comment: not done. 14) The discussion about the effect of the presence of the EGFP on growth could be enhanced by considering the implementation of supplementary experiments with the objective of elucidating its impact on specific physiological characteristics, such as mitochondrial and metabolic activities. The utilization of fluorescent microscopy (or flow cytometry) in conjunction with suitable fluorescent probes could be a viable avenue for exploration. New comment: not done. Competing Interests No competing interests were disclosed. Reviewer Expertise Yeast engineering, GFP expression in yeast, fluorescence microscopy, microbial growth, biochemistry, microbial food processes I confirm that I have read this submission and believe that I have an appropriate level of expertise to state that I do not consider it to be of an acceptable scientific standard, for reasons outlined above. reply Respond to this report Responses (0) Guyot S. Peer Review Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.172954.r343340) NOTE: it is important to ensure the information in square brackets after the title is included in this citation. The direct URL for this report is: https://f1000research.com/articles/12-1/v3#referee-response-343340 keyboard_arrow_left Back to all reports Reviewer Report 0 Views copyright © 2024 Huang Y. This is an open access peer review report distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. 24 Jul 2024 | for Version 2 Yide Huang , Fujian Normal University, Fuzhou, Fujian, China 0 Views copyright © 2024 Huang Y. This is an open access peer review report distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. format_quote Cite this report speaker_notes Responses (0) Not Approved info_outline Alongside their report, reviewers assign a status to the article: Approved The paper is scientifically sound in its current form and only minor, if any, improvements are suggested Approved with reservations A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit. Not approved Fundamental flaws in the paper seriously undermine the findings and conclusions The authors attempted to express EGFP and EGFP-polyR proteins with a 6×His tag in Saccharomyces cerevisiae for subsequent protein transduction studies. They synthesized EGFP and EGFP-polyR sequences, cloned them into the S. cerevisiae expression vector pYES2CT, and introduced the vector into the yeast S. cerevisiae INVSc1 to achieve the expression of EGFP and EGFP-polyR. However, there are several issues with the manuscript: 1. Figure 1 shows the process of constructing recombinant plasmids, which is part of the methods section, not the results. It is recommended to move it to the methods section under \"Plasmid design and construction.\" 2. The title of the figure legend should provide a summary description of the figure, not a description of the methods. 3. For Figure 4, it is recommended to combine panels A, B, and C into one figure and perform statistical comparisons. This will make it clearer for readers to distinguish the differences. Figure 4D is just another presentation of panels A, B, and C and constitutes redundant data, so it should be removed. 4. In Figure 5, the EGFP intensity observed in panel A at 72 hours is much stronger in the EGFP vector group compared to the EGFP-PolyA vector group. However, the quantitative results in panel B show no difference, indicating that the quantification method used in the manuscript is not accurate. It is suggested to use flow cytometry for detection and quantitative analysis. 5. The authors analyzed the expression of EGFP and EGFP-polyR in the yeast cells using Western blot. However, no distinct bands were observed, and the signal above the expected target band appears diffuse, likely due to non-specific binding of the His-tag antibody. Since EGFP antibodies are more specific than His-tag antibodies, it is recommended to use EGFP antibodies for detection. 6. There are still some mistypes in the manuscript that need to be corrected. Is the work clearly and accurately presented and does it cite the current literature? Partly Is the study design appropriate and is the work technically sound? Partly Are sufficient details of methods and analysis provided to allow replication by others? Yes If applicable, is the statistical analysis and its interpretation appropriate? Not applicable Are all the source data underlying the results available to ensure full reproducibility? Yes Are the conclusions drawn adequately supported by the results? Partly Competing Interests No competing interests were disclosed. Reviewer Expertise Pichia pastoris, Recombinant expression, Protein engineering, Applied microbiology I confirm that I have read this submission and believe that I have an appropriate level of expertise to state that I do not consider it to be of an acceptable scientific standard, for reasons outlined above. reply Respond to this report Responses (0) Huang Y. Peer Review Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.163692.r300366) NOTE: it is important to ensure the information in square brackets after the title is included in this citation. The direct URL for this report is: https://f1000research.com/articles/12-1/v2#referee-response-300366 keyboard_arrow_left Back to all reports Reviewer Report 0 Views copyright © 2024 Guyot S. This is an open access peer review report distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. 23 Jul 2024 | for Version 2 Stéphane Guyot , UMR Procédés Alimentaires et Microbiologiques, L'Institut Agro Dijon, Dijon, Bourgogne-Franche-Comté, France 0 Views copyright © 2024 Guyot S. This is an open access peer review report distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. format_quote Cite this report speaker_notes Responses (0) Not Approved info_outline Alongside their report, reviewers assign a status to the article: Approved The paper is scientifically sound in its current form and only minor, if any, improvements are suggested Approved with reservations A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit. Not approved Fundamental flaws in the paper seriously undermine the findings and conclusions The main aim of this paper is to propose a method for expressing a EGFP carrying C-terminal PolyR plus 6xHis-tag in the diploid Saccharomyces cerevisiae INVSc1 strain. Such an engineering approach is proposed to study and improve the transduction process that can be used for cell reprogramming to produce pluripotent stem cells. In general, the paper presents the different stages of yeast transformation by insertion of an appropriately modified plasmid, the effect of the presence of EGFP flanked or not by a PolyR sequence on yeast growth and a protein structure prediction of the EGFP tagged or not with PolyR and 6xHis tag. At this stage, there may be room for improvement in the paper. Some suggestions for enhancements are presented below for your consideration. Major comment 1) My main concern is the functionality of the proteins expressed in Saccharomyces cerevisiae . It is also a question of looking beyond the main objective of this study, which is to optimize the expression of these proteins. Although it would be tedious to carry out an experimental approach involving the cultivation of animal or human cells, I think that in the context of this study it would be interesting to ask whether post-translational modifications made by yeast, which cannot be detected by Western blotting, alter the desired functionality of modified EGFP (PolyR with or without 6xHis-tag) without affecting its fluorescence properties? To validate the present study, it would be advisable to extract the modified EGFP protein, bring it into contact with a human cell, and monitor its internalization (protein transduction) by fluorescence microscopy. Introduction section 2) From my point of view, the introductory section could be improved by not focusing only on one application based on stem cells, since there are a wide range of applications related to the use of protein transduction in various fields such as therapeutic delivery (drug and gene therapy), molecular biology research, regenerative medicine (stem cell engineering and tissue repair), vaccine development, diagnostics, and neuroscience. Methods section 3) Centrifugation steps: Please indicate the relative centrifugal force (x g) rather than the revolutions per minute (in rpm) throughout the paper. 4) Fluorescent Microscopy: Please clarify why yeasts were fixed with formaldehyde and not observed under a living state. Please indicate the version of the ImageJ software and the plugins utilized for the measurement of fluorescence intensity. As the distribution of fluorescence intensity is not uniform throughout the yeast, it is necessary to specify how the analysis was conducted. In particular, it is important to ascertain which pixels were taken into account. Please clarify whether the ratio of fluorescence intensity to yeast was taken into account. Please indicate the number of cells that were counted. The optimal approach is to conduct an analysis at the single-cell level to illustrate the distribution frequency of fluorescence intensity across the entire yeast population. This methodology enables the observation and subsequent discussion of the heterogeneity in EGFP expression. 5) Western Blotting: Please explain why SDS-PAGE was selected over native electrophoresis for detecting EGFP, given that it is a fluorescent protein. In light of this approach, the inclusion of an additional 6xHis-tag is unwarranted. Results section 6) Figure 2: Please indicate the molecular weight of each lane from the DNA ladder. 7) The data obtained with the empty plasmid are missing from Figures 3, 4, 5, and 6. This control procedure is essential for evaluating the impact of plasmid presence on yeast behavior. 8) Figure 4: Title: Saccharomyces cerevisiae should be written with in italics It should be easier for the reader to specify the lag time, the growth rate and the OD 600 max for each growth curve. It is possible to employ an online software such as Sym’Previus (https://symprevius.eu/en/), to calculate these parameters for each replicate and subsequently perform a statistical analysis. 9) Figure 5: It is necessary to compare the fluorescence intensity displayed by the mutants of interest with the fluorescence intensity displayed by a reference mutant expressing EGFP to more accurately assess the relevance of the fluorescence intensity (displayed by the mutants of interest). 10) Bioinformatics analysis: Does the software builds protein structures based on direct energy minimization? If so, were any additional 3D structures proposed that differ from those shown in the paper? 11) Figure 7: The proposed format for the legend is not conducive to rapid identification of the various regions within each sticker. It would be beneficial to include a title for each line or column, such as \"EGFP\" and \"PolyR EGFP,\" and consider utilizing a single color for a single region, thereby facilitating direct identification of the regions on each model. For example, it is not readily apparent which regions of the models are associated with the 6xHis-tag of the EGFP-PolyR protein. To facilitate comprehension, it would be beneficial to consider analogous color schemes between Figures 1 and 7. Discussion section 12) Section entitled “Modified protein plasmid insertion causes a decrease in the growth curve of S. cerevisiae ”: Please verify the following sentence: \"Adding raffinose to the growth medium of S. cerevisiae can activate the programmed cell death formation of acetic acid.\" Indeed, Guaragnella et al . (2013) demonstrated that yeast cells grown on raffinose exhibited enhanced resistance to acetic acid-induced programmed cell death (PCD). However, this observation does not necessarily imply that PCD was actively triggered in the presence of raffinose. The discussion should be more measured, given that the concentration of raffinose used in the Guaragnella et al . (2013) study was two times higher (2%) than that used in the present study (1%). It is therefore pertinent to inquire whether the activation of the retrograde pathway occurred at a lower concentration of raffinose. To reinforce this point, it would be beneficial to cite relevant papers in the field. 13) Table 1: It should be noted that the parameters presented in this table are not discussed in the paper. One might inquire, for instance, how the charges of EGFP and EGFP-PolyR are affected by the intracellular pH in yeast in relation to their pI. It would be beneficial to ascertain whether there are any consequences on EGFP aggregation and fluorescence, for example. For further insight, please consult the following paper, which will enhance the quality of the discussion: Nathalia Vieira dos Santos, Carolina Falaschi Saponi, Timothy M. Ryan, Fernando L. Primo, Tamar L. Greaves, Jorge F.B. Pereira. Reversible and irreversible fluorescence activity of the Enhanced Green Fluorescent Protein in pH: Insights for the development of pH-biosensors. International Journal of Biological Macromolecules, Volume 164, 2020, Pages 3474-3484. Complementary papers about intracellular pH in yeast could be found to reinforce the discussion. It would be beneficial for the reader to highlight the different regions of the protein sequences with varying colors (see comment 9). Furthermore, providing additional information about the sequence situated between the EGFP and 6xHis-tag in the EGFP sequence (EFCRYPAQWRPLESRGPFEGKPIPNPLLGLDSTRT) and the sequence between the EGFP and PolyR-6xHis-tag sequences in the EGFP-PolyR sequence (EFESGGGGSPG) would be beneficial. Why did the authors consider these two different “linkers”? 14) The discussion about the effect of the presence of the EGFP on growth could be enhanced by considering the implementation of supplementary experiments with the objective of elucidating its impact on specific physiological characteristics, such as mitochondrial and metabolic activities. The utilization of fluorescent microscopy (or flow cytometry) in conjunction with suitable fluorescent probes could be a viable avenue for exploration. Is the work clearly and accurately presented and does it cite the current literature? Partly Is the study design appropriate and is the work technically sound? Partly Are sufficient details of methods and analysis provided to allow replication by others? Partly If applicable, is the statistical analysis and its interpretation appropriate? Partly Are all the source data underlying the results available to ensure full reproducibility? Partly Are the conclusions drawn adequately supported by the results? Partly References 1. Dos Santos NV, Saponi CF, Ryan TM, Primo FL, et al.: Reversible and irreversible fluorescence activity of the Enhanced Green Fluorescent Protein in pH: Insights for the development of pH-biosensors. Int J Biol Macromol . 2020; 164 : 3474-3484 PubMed Abstract | Publisher Full Text Competing Interests No competing interests were disclosed. Reviewer Expertise Yeast engineering, GFP expression in yeast, fluorescence microscopy, microbial growth, biochemistry, microbial food processes I confirm that I have read this submission and believe that I have an appropriate level of expertise to state that I do not consider it to be of an acceptable scientific standard, for reasons outlined above. reply Respond to this report Responses (0) Guyot S. Peer Review Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.163692.r300364) NOTE: it is important to ensure the information in square brackets after the title is included in this citation. The direct URL for this report is: https://f1000research.com/articles/12-1/v2#referee-response-300364 keyboard_arrow_left Back to all reports Reviewer Report 0 Views copyright © 2023 Moriya H. This is an open access peer review report distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. 06 Nov 2023 | for Version 1 Hisao Moriya , Okayama University, Okayama, Japan 0 Views copyright © 2023 Moriya H. This is an open access peer review report distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. format_quote Cite this report speaker_notes Responses (0) Not Approved info_outline Alongside their report, reviewers assign a status to the article: Approved The paper is scientifically sound in its current form and only minor, if any, improvements are suggested Approved with reservations A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit. Not approved Fundamental flaws in the paper seriously undermine the findings and conclusions In this paper, the authors attempted to express EGFP-polyR in S. cerevisiae . They concluded that EGFP was successfully expressed and that the addition of polyR had no effect on the expression level of EGFP. However, the expression level of EGFP in S. cerevisiae seems to be much lower than the high expression level we know, and there are many possible improvements. Since many papers have been published on heterologous expression of fluorescent proteins in yeast, the authors should objectively judge how their level of technology compares with them. For example, our gTOW vector system can \"express EGFP to the limit,\" and in that case it can express enough EGFP to be recognized by SDS-PAGE in total protein without Western blotting 1 , 2 . Codon optimization is also mentioned by the authors. On the other hand, most yeast researchers, including us, use yEGFP3, a codon-optimized EGFP that maximizes expression in yeast 3 , which the authors should try first. In addition, for plasmid construction, you may want to consider introducing a strong homologous recombination cloning method, which is available in yeast 4 . Cell disruption by glass beads is also easier and less expensive than spheroplasting in yeast. In our experience, EGFP-his6 can be purified in large quantities with virtually no degradation. In fact, we have been using the above plasmid to express and purify yEGFP-his6 by glass bead disruption as a practical training for students. If necessary, the plasmid can be distributed by us. Finally, polyR is known to stall translation 5 , a finding that may be helpful when trying to express EGFP-polyR after successful mass expression of EGFP. Is the work clearly and accurately presented and does it cite the current literature? No Is the study design appropriate and is the work technically sound? Partly Are sufficient details of methods and analysis provided to allow replication by others? Yes If applicable, is the statistical analysis and its interpretation appropriate? Not applicable Are all the source data underlying the results available to ensure full reproducibility? Yes Are the conclusions drawn adequately supported by the results? Partly References 1. Kintaka R, Makanae K, Moriya H: Cellular growth defects triggered by an overload of protein localization processes. Sci Rep . 2016; 6 : 31774 PubMed Abstract | Publisher Full Text 2. Namba S, Kato H, Shigenobu S, Makino T, et al.: Massive expression of cysteine-containing proteins causes abnormal elongation of yeast cells by perturbing the proteasome. G3 (Bethesda) . 2022; 12 (6). PubMed Abstract | Publisher Full Text 3. Cormack BP, Bertram G, Egerton M, Gow NAR, et al.: Yeast-enhanced green fluorescent protein (yEGFP): a reporter of gene expression in Candida albicans. Microbiology (Reading) . 1997; 143 ( Pt 2) : 303-311 PubMed Abstract | Publisher Full Text 4. Oldenburg KR, Vo KT, Michaelis S, Paddon C: Recombination-mediated PCR-directed plasmid construction in vivo in yeast. Nucleic Acids Res . 1997; 25 (2): 451-2 PubMed Abstract | Publisher Full Text 5. Kriachkov V, Ormsby AR, Kusnadi EP, McWilliam HEG, et al.: Arginine-rich C9ORF72 ALS proteins stall ribosomes in a manner distinct from a canonical ribosome-associated quality control substrate. J Biol Chem . 2023; 299 (1): 102774 PubMed Abstract | Publisher Full Text Competing Interests No competing interests were disclosed. Reviewer Expertise Yeast, overexpression, plasmid construction, systems biology I confirm that I have read this submission and believe that I have an appropriate level of expertise to state that I do not consider it to be of an acceptable scientific standard, for reasons outlined above. reply Respond to this report Responses (0) Moriya H. Peer Review Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.135264.r177225) NOTE: it is important to ensure the information in square brackets after the title is included in this citation. The direct URL for this report is: https://f1000research.com/articles/12-1/v1#referee-response-177225 keyboard_arrow_left Back to all reports Reviewer Report 0 Views copyright © 2023 Hasan K. This is an open access peer review report distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. 03 Nov 2023 | for Version 1 Khomaini Hasan , Faculty of Medicine, Universitas Jenderal Achmad Yani, Cimahi, Indonesia 0 Views copyright © 2023 Hasan K. This is an open access peer review report distributed under the terms of the Creative Commons Attribution License , which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. format_quote Cite this report speaker_notes Responses (0) Not Approved info_outline Alongside their report, reviewers assign a status to the article: Approved The paper is scientifically sound in its current form and only minor, if any, improvements are suggested Approved with reservations A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit. Not approved Fundamental flaws in the paper seriously undermine the findings and conclusions Pramono and Co-workers study on expression of recombinant Enhanced Green Fluorescent Protein (EGFP) with some modification with the addition of poly-R in order to help protein penetration within cells. In general, the work can be significantly improved, especially in terms of quality of the data due to lack of evidence that are correlated with the conclusions. First, as we read in the article, Pramono and co-workers were struggling on how to express and obtained the recombinant protein in sufficient amount. Even though, the Western Blot microscopic data which were presented in the manuscript confirms the success of protein expression, but the quality of SDS PAGE gels did not fully support their conclusion. The gel itself lacks some data and low quality, for instance, no clear molecular weight marker and the bands, which were considered as expressed proteins, were almost invisible. Second, the quantitative methodology, which were conducted and presented here, is mostly not effective to be done, because most of them show unexpected results. For instance, when they claimed that the expressed protein was low, they did ultrafiltration with 5 kDa cutoff and resulted no significant improvement. They also failed to prove that additional 6-his-tag in the recombinant protein is useful for their experiment as well. In order to answer our curiosity on the 6-histag, I would suggest to do a protein purification, so the claim of structure model that were presented in the manuscript can be proven and relevant. Third, the claim on the effect of plasmid toward growth of the yeast is weak due to lack of repetition to the experiment. If the experiment is conducted triplicates, the potential bias can be reduced and the issue of reproducibility may not occur. Additionally, the genetic optimization which was conducted computationally are useless due to having no experimental data that support the claim. Fourth, the quality of the figures is very poor in quality. The authors can improve by using a camera or similar equipment that meets the requirement of the quality. Lastly, some mistypes can be prevented. Is the work clearly and accurately presented and does it cite the current literature? Partly Is the study design appropriate and is the work technically sound? Partly Are sufficient details of methods and analysis provided to allow replication by others? Partly If applicable, is the statistical analysis and its interpretation appropriate? Not applicable Are all the source data underlying the results available to ensure full reproducibility? Partly Are the conclusions drawn adequately supported by the results? Partly Competing Interests No competing interests were disclosed. Reviewer Expertise Protein chemistry, protein engineering, enzymology, protein therapeutics, biocatalysis and biotransformation I confirm that I have read this submission and believe that I have an appropriate level of expertise to state that I do not consider it to be of an acceptable scientific standard, for reasons outlined above. reply Respond to this report Responses (0) Hasan K. Peer Review Report For: Structural and Functional Implications of Polyarginine Addition to Green Fluorescent Protein Expression in Saccharomyces cerevisiae INVSc1 [version 3; peer review: 5 not approved] . F1000Research 2024, 12 :1 ( https://doi.org/10.5256/f1000research.135264.r159002) NOTE: it is important to ensure the information in square brackets after the title is included in this citation. The direct URL for this report is: https://f1000research.com/articles/12-1/v1#referee-response-159002 Alongside their report, reviewers assign a status to the article: Approved - the paper is scientifically sound in its current form and only minor, if any, improvements are suggested Approved with reservations - A number of small changes, sometimes more significant revisions are required to address specific details and improve the papers academic merit. Not approved - fundamental flaws in the paper seriously undermine the findings and conclusions Adjust parameters to alter display View on desktop for interactive features Includes Interactive Elements View on desktop for interactive features Competing Interests Policy Provide sufficient details of any financial or non-financial competing interests to enable users to assess whether your comments might lead a reasonable person to question your impartiality. Consider the following examples, but note that this is not an exhaustive list: Examples of 'Non-Financial Competing Interests' Within the past 4 years, you have held joint grants, published or collaborated with any of the authors of the selected paper. You have a close personal relationship (e.g. parent, spouse, sibling, or domestic partner) with any of the authors. You are a close professional associate of any of the authors (e.g. scientific mentor, recent student). You work at the same institute as any of the authors. You hope/expect to benefit (e.g. favour or employment) as a result of your submission. You are an Editor for the journal in which the article is published. Examples of 'Financial Competing Interests' You expect to receive, or in the past 4 years have received, any of the following from any commercial organisation that may gain financially from your submission: a salary, fees, funding, reimbursements. You expect to receive, or in the past 4 years have received, shared grant support or other funding with any of the authors. You hold, or are currently applying for, any patents or significant stocks/shares relating to the subject matter of the paper you are commenting on. Stay Updated Sign up for content alerts and receive a weekly or monthly email with all newly published articles Register with F1000Research Already registered? Sign in Not now, thanks close PLEASE NOTE If you are an AUTHOR of this article, please check that you signed in with the account associated with this article otherwise we cannot automatically identify your role as an author and your comment will be labelled as a “User Comment”. If you are a REVIEWER of this article, please check that you have signed in with the account associated with this article and then go to your account to submit your report, please do not post your review here. If you do not have access to your original account, please contact us . All commenters must hold a formal affiliation as per our Policies . The information that you give us will be displayed next to your comment. User comments must be in English, comprehensible and relevant to the article under discussion. We reserve the right to remove any comments that we consider to be inappropriate, offensive or otherwise in breach of the User Comment Terms and Conditions . Commenters must not use a comment for personal attacks. When criticisms of the article are based on unpublished data, the data should be made available. I accept the User Comment Terms and Conditions Please confirm that you accept the User Comment Terms and Conditions. Affiliation ✕ refresh Please enter your institution. Note: To add your institution or organisation, start typing the name and then select the correct name from the list. Where applicable, the name will appear in both the original language and in English. Do not paste in the name. If the name does not appear in the drop-down list, we will display the information you have entered. ✕ refresh Country/Region * USA UK Canada China France Germany Afghanistan Aland Islands Albania Algeria American Samoa Andorra Angola Anguilla Antarctica Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahamas Bahrain Bangladesh Barbados Belarus Belgium Belize Benin Bermuda Bhutan Bolivia Bosnia and Herzegovina Botswana Bouvet Island Brazil British Indian Ocean Territory British Virgin Islands Brunei Bulgaria Burkina Faso Burundi Cambodia Cameroon Canada Cape Verde Cayman Islands Central African Republic Chad Chile China Christmas Island Cocos (Keeling) Islands Colombia Comoros Congo Cook Islands Costa Rica Cote d'Ivoire Croatia Cuba Cyprus Czech Republic Democratic Republic of the Congo Denmark Djibouti Dominica Dominican Republic Ecuador Egypt El Salvador Equatorial Guinea Eritrea Estonia Ethiopia Falkland Islands Faroe Islands Federated States of Micronesia Fiji Finland France French Guiana French Polynesia French Southern Territories Gabon Georgia Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guam Guatemala Guernsey Guinea Guinea-Bissau Guyana Haiti Heard Island and Mcdonald Islands Holy See (Vatican City State) Honduras Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Jamaica Japan Jersey Jordan Kazakhstan Kenya Kiribati Kosovo (Serbia and Montenegro) Kuwait Kyrgyzstan Lao People's Democratic Republic Latvia Lebanon Lesotho Liberia Libya Liechtenstein Lithuania Luxembourg Macao Madagascar Malawi Malaysia Maldives Mali Malta Marshall Islands Martinique Mauritania Mauritius Mayotte Mexico Minor Outlying Islands of the United States Moldova Monaco Mongolia Montenegro Montserrat Morocco Mozambique Myanmar Namibia Nauru Nepal Netherlands Antilles New Caledonia New Zealand Nicaragua Niger Nigeria Niue Norfolk Island North Korea North Macedonia Northern Mariana Islands Norway Oman Pakistan Palau Palestinian Territory Panama Papua New Guinea Paraguay Peru Philippines Pitcairn Poland Portugal Puerto Rico Qatar Reunion Romania Russian Federation Rwanda Saint Helena Saint Kitts and Nevis Saint Lucia Saint Pierre and Miquelon Saint Vincent and the Grenadines Samoa San Marino Sao Tome and Principe Saudi Arabia Senegal Serbia Seychelles Sierra Leone Singapore Slovakia Slovenia Solomon Islands Somalia South Africa South Georgia and the South Sandwich Is South Korea South Sudan Spain Sri Lanka Sudan Suriname Svalbard and Jan Mayen Swaziland Sweden Switzerland Syria Taiwan Tajikistan Tanzania Thailand The Gambia The Netherlands Timor-Leste Togo Tokelau Tonga Trinidad and Tobago Tunisia Turkey Turkmenistan Turks and Caicos Islands Tuvalu UK USA Uganda Ukraine United Arab Emirates United States Virgin Islands Uruguay Uzbekistan Vanuatu Venezuela Vietnam Wallis and Futuna West Bank and Gaza Strip Western Sahara Yemen Zambia Zimbabwe Please select your country/region. You must enter a comment. Competing Interests Please disclose any competing interests that might be construed to influence your judgment of the article's or peer review report's validity or importance. Competing Interests Policy Provide sufficient details of any financial or non-financial competing interests to enable users to assess whether your comments might lead a reasonable person to question your impartiality. Consider the following examples, but note that this is not an exhaustive list: Examples of 'Non-Financial Competing Interests' Within the past 4 years, you have held joint grants, published or collaborated with any of the authors of the selected paper. You have a close personal relationship (e.g. parent, spouse, sibling, or domestic partner) with any of the authors. You are a close professional associate of any of the authors (e.g. scientific mentor, recent student). You work at the same institute as any of the authors. You hope/expect to benefit (e.g. favour or employment) as a result of your submission. You are an Editor for the journal in which the article is published. Examples of 'Financial Competing Interests' You expect to receive, or in the past 4 years have received, any of the following from any commercial organisation that may gain financially from your submission: a salary, fees, funding, reimbursements. You expect to receive, or in the past 4 years have received, shared grant support or other funding with any of the authors. You hold, or are currently applying for, any patents or significant stocks/shares relating to the subject matter of the paper you are commenting on. Please state your competing interests The comment has been saved. An error has occurred. Please try again. Cancel Post var lTitle = \"Structural and Functional Implications of...\".replace(\"'\", ''); var linkedInUrl = \"http://www.linkedin.com/shareArticle?url=https://f1000research.com/articles/12-1/v3\" + \"&title=\" + encodeURIComponent(lTitle) + \"&summary=\" + encodeURIComponent('Read the article by '); var deliciousUrl = \"https://del.icio.us/post?url=https://f1000research.com/articles/12-1/v3&title=\" + encodeURIComponent(lTitle); var redditUrl = \"http://reddit.com/submit?url=https://f1000research.com/articles/12-1/v3\" + \"&title=\" + encodeURIComponent(lTitle); linkedInUrl += encodeURIComponent('Tandio Saputro SS et al.'); var offsetTop = /chrome/i.test( navigator.userAgent ) ? 4 : -10; var addthis_config = { ui_offset_top: offsetTop, services_compact : \"facebook,twitter,www.linkedin.com,www.mendeley.com,reddit.com\", services_expanded : \"facebook,twitter,www.linkedin.com,www.mendeley.com,reddit.com\", services_custom : [ { name: \"LinkedIn\", url: linkedInUrl, icon:\"/img/icon/at_linkedin.svg\" }, { name: \"Mendeley\", url: \"http://www.mendeley.com/import/?url=https://f1000research.com/articles/12-1/v3/mendeley\", icon:\"/img/icon/at_mendeley.svg\" }, { name: \"Reddit\", url: redditUrl, icon:\"/img/icon/at_reddit.svg\" }, ] }; var addthis_share = { url: \"https://f1000research.com/articles/12-1\", templates : { twitter : \"Structural and Functional Implications of Polyarginine Addition.... Tandio Saputro SS et al., published by \" + \"@F1000Research\" + \", https://f1000research.com/articles/12-1/v3\" } }; if (typeof(addthis) != \"undefined\"){ addthis.addEventListener('addthis.ready', checkCount); addthis.addEventListener('addthis.menu.share', checkCount); } $(\".f1r-shares-twitter\").attr(\"href\", \"https://twitter.com/intent/tweet?text=\" + addthis_share.templates.twitter); $(\".f1r-shares-facebook\").attr(\"href\", \"https://www.facebook.com/sharer/sharer.php?u=\" + addthis_share.url); $(\".f1r-shares-linkedin\").attr(\"href\", addthis_config.services_custom[0].url); $(\".f1r-shares-reddit\").attr(\"href\", addthis_config.services_custom[2].url); $(\".f1r-shares-mendelay\").attr(\"href\", addthis_config.services_custom[1].url); function checkCount(){ setTimeout(function(){ $(\".addthis_button_expanded\").each(function(){ var count = $(this).text(); if (count !== \"\" && count != \"0\") $(this).removeClass(\"is-hidden\"); else $(this).addClass(\"is-hidden\"); }); }, 1000); } close How to cite this report {{reportCitation}} Cancel Copy Citation Details $(function(){R.ui.buttonDropdowns('.dropdown-for-downloads');}); $(function(){R.ui.toolbarDropdowns('.toolbar-dropdown-for-downloads');}); $.get(\"/articles/acj/123181/172954\") new F1000.Clipboard(); new F1000.ThesaurusTermsDisplay(\"articles\", \"article\", \"172954\"); $(document).ready(function() { $( \"#frame1\" ).on('load', function() { var mydiv = $(this).contents().find(\"div\"); var h = mydiv.height(); console.log(h) }); var tooltipLivingFigure = jQuery(\".interactive-living-figure-label .icon-more-info\"), titleLivingFigure = tooltipLivingFigure.attr(\"title\"); tooltipLivingFigure.simpletip({ fixed: true, position: [\"-115\", \"30\"], baseClass: 'small-tooltip', content:titleLivingFigure + \" \" }); tooltipLivingFigure.removeAttr(\"title\"); $(\"body\").on(\"click\", \".cite-living-figure\", function(e) { e.preventDefault(); var ref = $(this).attr(\"data-ref\"); $(this).closest(\".living-figure-list-container\").find(\"#\" + ref).fadeIn(200); }); $(\"body\").on(\"click\", \".close-cite-living-figure\", function(e) { e.preventDefault(); $(this).closest(\".popup-window-wrapper\").fadeOut(200); }); $(document).on(\"mouseup\", function(e) { var metricsContainer = $(\".article-metrics-popover-wrapper\"); if (!metricsContainer.is(e.target) && metricsContainer.has(e.target).length === 0) { $(\".article-metrics-close-button\").click(); } }); var articleId = $('#articleId').val(); if($(\"#main-article-count-box\").attachArticleMetrics) { $(\"#main-article-count-box\").attachArticleMetrics(articleId, { articleMetricsView: true }); } }); var figshareWidget = $(\".new_figshare_widget\"); if (figshareWidget.length > 0) { window.figshare.load(\"f1000\", function(Widget) { // Select a tag/tags defined in your page. In this tag we will place the widget. _.map(figshareWidget, function(el){ var widget = new Widget({ articleId: $(el).attr(\"figshare_articleId\") //height:300 // this is the height of the viewer part. [Default: 550] }); widget.initialize(); // initialize the widget widget.mount(el); // mount it in a tag that's on your page // this will save the widget on the global scope for later use from // your JS scripts. This line is optional. //window.widget = widget; }); }); } close Error Close Add Reset F1000.MICROSERVICES.AFFILIATION = ''; $(document).ready(function () { $('.js-affiliations-form').each((index, form) => { new AffiliationForm({ formId: form.id, institutionErrorSelector: '.comment-enter-institution', departmentErrorSelector: '.comment-enter-department', placeSelector: '.js-add-comment-place', stateSelector: '.js-add-comment-state', zipCodeSelector: '.js-add-comment-zipcode', countrySelector: '.js-add-comment-country', countryErrorSelector: '.comment-enter-country', }); }); }); $(document).ready(function () { var reportIds = { \"161038\": 0, \"159002\": 55, \"159003\": 0, \"159000\": 0, \"159001\": 0, \"343341\": 0, \"343340\": 11, \"343343\": 0, \"343342\": 0, \"358725\": 0, \"358727\": 0, \"358726\": 0, \"358733\": 0, \"177226\": 0, \"300364\": 17, \"358732\": 0, \"177227\": 0, \"300365\": 0, \"177224\": 0, \"300366\": 17, \"358734\": 0, \"177225\": 29, \"300367\": 0, \"358729\": 0, \"177230\": 0, \"358728\": 0, \"177231\": 0, \"358731\": 0, \"177228\": 0, \"358730\": 0, \"177229\": 0, \"177232\": 0, \"177233\": 0, \"300368\": 0, \"300369\": 0, \"300370\": 0, \"351837\": 0, \"351836\": 0, \"351839\": 0, \"351838\": 0, \"351845\": 0, \"351844\": 0, \"351841\": 0, \"351840\": 0, \"351843\": 0, \"351842\": 0, \"356205\": 0, \"356204\": 0, \"356207\": 0, \"356206\": 0, \"356213\": 0, \"356212\": 0, \"356209\": 0, \"356208\": 0, \"356211\": 0, \"356210\": 0, \"218747\": 0, \"218746\": 0, \"218745\": 0, \"218744\": 0, \"218750\": 0, \"218749\": 0, \"218748\": 1, \"218754\": 0, \"218753\": 0, \"218752\": 0, \"259974\": 0, \"259973\": 0, \"349077\": 0, \"349076\": 0, \"349079\": 0, \"349078\": 0, \"182935\": 0, \"349075\": 0, \"349074\": 0, \"349085\": 0, \"182938\": 0, \"182939\": 0, \"182936\": 0, \"182937\": 0, \"349081\": 0, \"182942\": 0, \"349080\": 0, \"182943\": 0, \"182940\": 0, \"182941\": 0, \"349088\": 0, \"354221\": 0, \"354220\": 0, \"182955\": 0, \"354223\": 0, \"354222\": 0, \"354229\": 0, \"354228\": 0, \"282550\": 0, \"282551\": 0, \"354225\": 0, \"354224\": 0, \"354227\": 0, \"354226\": 0, \"360637\": 0, \"282556\": 0, \"282557\": 0, \"360639\": 0, \"282558\": 0, \"360638\": 0, \"282559\": 0, \"282552\": 0, \"282553\": 0, \"360635\": 0, \"282554\": 0, \"282555\": 0, \"360645\": 0, \"360644\": 0, \"360641\": 0, \"360640\": 15, \"360643\": 0, \"360642\": 0, \"325338\": 0, \"192746\": 0, \"192744\": 0, \"192750\": 0, \"192748\": 0, \"192749\": 0, \"192754\": 0, \"192753\": 0, \"192758\": 0, \"192759\": 0, \"192757\": 0, \"324600\": 0, }; $(\".referee-response-container,.js-referee-report\").each(function(index, el) { var reportId = $(el).attr(\"data-reportid\"), reportCount = reportIds[reportId] || 0; $(el).find(\".comments-count-container,.js-referee-report-views\").html(reportCount); }); var uuidInput = $(\"#article_uuid\"), oldUUId = uuidInput.val(), newUUId = \"56149fd1-d3d6-45a3-86ae-277bd773d23a\"; uuidInput.val(newUUId); $(\"a[href*='article_uuid=']\").each(function(index, el) { var newHref = $(el).attr(\"href\").replace(oldUUId, newUUId); $(el).attr(\"href\", newHref); }); }); An innovative open access publishing platform offering rapid publication and open peer review, whilst supporting data deposition and sharing. Browse Gateways Collections How it Works Contact For Developers Cookie Notice Privacy Notice RSS Submit Your Research Follow us © 2012-2026 F1000 Research Ltd. ISSN 2046-1402 | Legal | Partner of Research4Life • CrossRef • ORCID • FAIRSharing R.templateTests.simpleTemplate = R.template(' $text $text $text $text $text '); R.templateTests.runTests(); var F1000platform = new F1000.Platform({ name: \"f1000research\", displayName: \"F1000Research\", hostName: \"f1000research.com\", id: \"1\", editorialEmail: \"research@f1000.com\", infoEmail: \"info@f1000.com\", usePmcStats: true }); $(function(){R.ui.dropdowns('.dropdown-for-authors, .dropdown-for-about, .dropdown-for-myresearch');}); // $(function(){R.ui.dropdowns('.dropdown-for-referees');}); $(document).ready(function () { if ($(\".cookie-warning\").is(\":visible\")) { $(\".sticky\").css(\"margin-bottom\", \"35px\"); $(\".devices\").addClass(\"devices-and-cookie-warning\"); } $(\".cookie-warning .close-button\").click(function (e) { $(\".devices\").removeClass(\"devices-and-cookie-warning\"); $(\".sticky\").css(\"margin-bottom\", \"0\"); }); $(\"#tweeter-feed .tweet-message\").each(function (i, message) { var self = $(message); self.html(linkify(self.html())); }); $(\".partner\").on(\"mouseenter mouseleave\", function() { $(this).find(\".gray-scale, .colour\").toggleClass(\"is-hidden\"); }); }); <!-- Sign in --> Sign In Remember me Forgotten your password? Sign In Cancel Email or password not correct. Please try again Please wait... $(function(){ // Note: All the setup needs to run against a name attribute and *not* the id due the clonish // nature of facebox... $(\"a[id=googleSignInButton]\").click(function(event){ event.preventDefault(); $(\"input[id=oAuthSystem]\").val(\"GOOGLE\"); $(\"form[id=oAuthForm]\").submit(); }); $(\"a[id=facebookSignInButton]\").click(function(event){ event.preventDefault(); $(\"input[id=oAuthSystem]\").val(\"FACEBOOK\"); $(\"form[id=oAuthForm]\").submit(); }); $(\"a[id=orcidSignInButton]\").click(function(event){ event.preventDefault(); $(\"input[id=oAuthSystem]\").val(\"ORCID\"); $(\"form[id=oAuthForm]\").submit(); }); }); If you've forgotten your password, please enter your email address below and we'll send you instructions on how to reset your password. The email address should be the one you originally registered with F1000. Email address not valid, please try again You registered with F1000 via Google, so we cannot reset your password. To sign in, please click here . If you still need help with your Google account password, please click here . You registered with F1000 via Facebook, so we cannot reset your password. To sign in, please click here . If you still need help with your Facebook account password, please click here . Code not correct, please try again Reset password Cancel Email us for further assistance. Server error, please try again. If your email address is registered with us, we will email you instructions to reset your password. If you think you should have received this email but it has not arrived, please check your spam filters and/or contact for further assistance. Please wait... Register $(document).ready(function () { signIn.createSignInAsRow($(\"#sign-in-form-gfb-popup\")); $(\".target-field\").each(function () { var uris = $(this).val().split(\"/\"); if (uris.pop() === \"login\") { $(this).val(uris.toString().replace(\",\",\"/\")); } }); });","source_license":"CC-BY-4.0","license_restricted":false}